KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0769Help
Entry
LBF_0769          CDS       T00712                                 

Gene name
btuE-1
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LBF_0769 (btuE-1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBF_0769 (btuE-1)
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBF_0769 (btuE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:820525..821010
Genome map
AA seq 161 aa AA seqDB search
MAEEFYNIKVKRGSEEIPMEQFKDKVLLIVNTASQCGFTPQYKGLQETYDRWKGKGLEIL
AFPCNQFGEQEPGSDADIKLFCEKTFSTTFPIFSKLEVNGPNTDALYMHLKKNAPGIFGS
LDIKWNFTKFLVDKNGKVVKRYAPITKPEAIEKDIEKLVQG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaattttacaatattaaagtgaaacgtggatcggaagagattcctatggaa
caatttaaagataaggtattgttgattgtgaataccgcaagtcagtgtggcttcactcca
caatataaaggcctgcaagaaacttatgatcgttggaaaggcaaaggtttggaaatttta
gctttcccttgtaaccagttcggagaacaagaacctggctccgatgcagatataaaattg
ttttgtgaaaaaacattttctacaactttcccaatcttttctaagctcgaagtgaacggt
ccaaatacggatgcactttatatgcatttaaaaaagaatgcaccaggaatttttggttct
cttgatatcaaatggaattttacaaagttcttagtcgataaaaatggaaaggttgttaaa
agatatgcaccgattacaaaacctgaagcaatcgagaaggatatcgaaaagcttgtccaa
ggttaa

DBGET integrated database retrieval system