KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0932Help
Entry
LBF_0932          CDS       T00712                                 

Definition
lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LBF_0932
Enzymes [BR:lbf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LBF_0932
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LBF_0932
Lipid biosynthesis proteins [BR:lbf01004]
 Fatty acid synthase
  Component type
   LBF_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1007622..1008284
Genome map
AA seq 220 aa AA seqDB search
MPYFLTFLSLFIALGCGKPSDQTQDPKTQSIESNQTKRILYFGDSLTAGYGLSNYEDAWP
HVLTNRINAEGYFYQMTNAGVSGDTTSGGLGRLEWVLAEKPSIFVLELGANDMLRGISPS
VTKENLRSMIRQIKSLYPNTKILLVGMMATPNMGKKYANAFNSIYPDLAKEENVPLVPFI
LEKVATIRKLNQKDGIHPTDAGHKLVADTVYPYIKPLLEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccgtattttttaacctttctttctttattcattgcccttggttgtgggaaaccttcc
gaccaaacacaagatccaaaaactcaatcgatagaatcaaaccaaaccaaacggattttg
tattttggtgattccttgaccgctgggtatggcctaagcaattatgaagatgcttggccc
catgttctcacaaaccgcatcaatgcggaaggttatttttatcaaatgacaaatgcggga
gtatcaggtgatacaacaagtggagggcttggaaggttggaatgggtgcttgcggaaaaa
ccttccatctttgtgctcgagttaggtgccaatgatatgttgcgagggatcagtccttcc
gtcacaaaagaaaacttacgttccatgatccgccaaatcaaatctttatacccaaacacc
aaaatattgttagttggtatgatggccactcccaatatggggaaaaaatatgcgaatgca
ttcaattcaatttatccagatcttgccaaagaagagaatgtccctctagttccctttatc
ttagaaaaagtggccacaattcgaaaactcaatcaaaaggatggaatccatcctacagat
gccggccataaattggtagcggacactgtgtacccttacataaaaccactactagaaaaa
tag

DBGET integrated database retrieval system