KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1164Help
Entry
LBF_1164          CDS       T00712                                 

Gene name
mauG-1
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Brite
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LBF_1164 (mauG-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1266603..1267841)
Genome map
AA seq 412 aa AA seqDB search
MKYWFVFGFITSVLILYDCSKAETRIIPELSKFEVVEPPLDFHLSTVCPSGLKLEKGFCA
IDYRYVPSLEKNGGLGQTLPLVKLDPKVIDLGRYLFFDPILSGDKQLSCAHCHHPAYSLS
DGQKQSIGRGGIGYGPMRKNGVILKRSAPSLWNVVYMKNLFWEGRASHLEDQAEGPLYSP
DEMGSSPEIIESRLNENSDYKKMFRQAYGEKGSKISASLVIDALSTFERSLVSFSSRFDK
WSTGDKEALNTEELLGYNVFRSFVARCAECHPPPMFTNNVFATIGVLDSKERDFGRETIT
GQDLLRGAFRVPSLRNIAKTAPYMHAGNLNTLEEVIRFYNEGGGRGNGAPSDLRIHWHVR
KMGLSKKEISSIISFLNTLTDETSMPKFPKSVPSGLPVALEFESFQNRSSIK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtattggtttgtttttggattcataacctctgtcctcatcctttatgattgttca
aaggctgagactagaatcattccagagttatccaaatttgaagtagtggaacctccttta
gatttccacctttcgactgtttgcccttcgggactaaaacttgaaaaaggtttttgtgcg
attgactatcgctatgttccctctttggaaaaaaatgggggccttggtcaaactcttccc
ttagttaagttagatcccaaagtcattgacttgggaaggtatttattttttgatcccatt
ctctctggcgataaacaattgtcatgtgctcattgtcaccacccagcctatagtctctct
gacggacagaaacaaagtatagggagaggcggtattggttatggaccgatgcgaaaaaat
ggagttatactcaaacgatcggccccaagtttgtggaatgtggtttatatgaagaatttg
ttttgggagggaagagcttcccacttagaagaccaagcagaaggaccactttattcgcct
gatgaaatggggagttcgccagaaatcattgaatcaaggttaaacgaaaattctgattat
aaaaaaatgtttagacaagcttatggtgaaaagggatcaaaaatttcagcatcacttgtg
attgacgctttatccacttttgagaggtcactagtctctttcagtagtcggtttgacaag
tggtctacaggagataaagaagcattgaacacagaagagttgttgggttataatgttttc
cggtcttttgtggcccgctgtgccgaatgccatcctcctcctatgtttactaataatgtt
tttgcaacgattggtgttttggattcgaaagaacgcgactttggaagagaaaccattact
ggccaagacttactcagaggagccttccgggttcctagtttgagaaatatagctaaaacg
gccccttatatgcatgcgggaaatttgaatactttagaagaagtgattcgtttttataat
gagggtgggggaagagggaacggagcaccgagtgatctcagaattcattggcatgtcaga
aaaatgggactcagtaaaaaagagattagctcaatcatttcttttctgaatacattgact
gatgaaactagtatgccaaaatttcctaagtcggtcccttcgggtctaccagttgcacta
gaatttgaatcatttcaaaatcggagttctataaaataa

DBGET integrated database retrieval system