KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1254Help
Entry
LBF_1254          CDS       T00712                                 

Definition
ARD family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBF_1254
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     LBF_1254
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     LBF_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1368358..1368897
Genome map
AA seq 179 aa AA seqDB search
MEMATIVKKQETIQDKDQVKAYLTQKGLVYESYKTPESLDLILGQKGLSDAEKEEVLSGL
EYRFDQLKKQHGYKANDLVVLHDEVPGISDMLAKFDKLHIHTDEEVRYIIDGSGIFGFII
DGERFEVHVGKGDFISIPANTNHWFTLDQTMRIKAVRYFKDNSGWTPVYVDESKVLINA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcaacgatagtcaaaaaacaagaaacgatccaggacaaagaccaagtgaaa
gcatacctgacccaaaaagggcttgtgtatgaatcttacaaaactcctgaatctttggat
ttgatcctcggccaaaaaggtttatccgatgcggaaaaagaagaagtcctttctggtctg
gaataccgatttgaccaattgaaaaaacaacatggctacaaagcaaacgaccttgtggtc
cttcatgacgaagtgccagggatcagtgacatgttagctaaatttgacaaacttcacatc
catacagatgaagaagttcgttacatcattgatgggagtgggatttttggcttcatcatt
gacggagaacgatttgaagtccatgttgggaaaggtgattttatctccatccctgccaat
acaaaccactggttcacattggaccaaacaatgcggatcaaagccgttcgatactttaag
gacaactcaggttggacacccgtttatgtggatgaatcgaaagtcctcatcaatgcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system