KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1269Help
Entry
LBF_1269          CDS       T00712                                 

Gene name
glpK-1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBF_1269 (glpK-1)
Enzymes [BR:lbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBF_1269 (glpK-1)
Exosome [BR:lbf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBF_1269 (glpK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1383757..1385253
Genome map
AA seq 498 aa AA seqDB search
MAKKNYIIGIDAGTTGIRTFCFNDKGKVISSAYQEFKQYYPKPGWVEHDPEEIWVKTQKL
ITLAIKNGKLNPKDAVAIGITNQRETSVVWDKKTGKPVYNAIVWQCRRTSDICKDLKKQS
LDSNFRNKTGLVLDAYFSGTKIQWILDNVKGARDRAERGDLLFGTIDTWLLYKLTGHKEH
KTDHTNASRTLLFNIQTKEWDEELCKILRVPMSMLPKAFNSKNLFGFTSNVKSIPDGIPI
SSLVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNVGDEFRISNQGLITTLALGPEGKTV
YCLEGSVFIGGAVVQFLRDNLEFFKYSKDSEKLVKSIKTKDDIVFVPAFAGLGAPHWDQE
ARGAIFGLSRDTTPAQITRAALKAIALQSYELANAMEKETGKPLKFLRVDGGATSNAWLM
QFQADILGTKVIRPQNVDTTVLGAAYLAGLERGFFKSVAHLRKEETKTTQFTPKMKESER
KEEIDKWNLAISRVKTET
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaaattacatcattggaattgatgcaggtacaactgggattcgtacattt
tgttttaatgacaaagggaaagtgatctcctcggcttaccaagagttcaaacaatactat
ccaaaaccaggttgggtggaacatgacccagaagagatttgggtaaaaacacaaaagctc
atcacacttgccattaaaaatggaaagttaaatcccaaagatgccgtggccattgggatc
acaaaccaaagggaaacttcggttgtttgggataaaaaaacaggaaaacctgtttataat
gccatcgtttggcaatgccgacgtacttctgatatttgtaaggacttaaaaaaacaaagc
ctagattccaattttcgaaataaaacagggctagtcctagatgcttatttttcaggtacc
aaaatccaatggatcttagacaatgtgaaaggggcaagggatcgggcagaacgtggtgac
cttctttttggaaccattgatacctggttattgtacaaactcacaggccataaagaacat
aaaaccgatcataccaatgcatctcgaaccttactttttaatatccaaaccaaagaatgg
gatgaagaactatgtaagattttaagagttcccatgtccatgttaccgaaggcatttaac
tccaaaaatctctttgggtttacttctaatgtcaaatccatcccagatggaatcccaatt
tcttcgttagttggtgaccaacaaggggcactctttggacaactttgtacagaaccaggg
gaagccaaaaatacctatggaacgggttgttttttactattcaatgtgggggatgaattc
cggatttcgaaccaaggtctcatcaccacattggccctcggtccagaagggaaaactgtg
tactgtttggaaggatctgtttttatcgggggtgctgtggtccaattcctccgagacaat
ttggaattttttaaatactcaaaagactcggaaaaactcgtgaagtcgatcaaaacaaaa
gatgatattgtgtttgttcctgcctttgcaggtcttggtgccccgcattgggaccaagaa
gcacgtggtgccatctttggactctctcgtgacacaacgcctgcccaaatcacaagagcc
gctctcaaagccattgccttacaatcctatgaacttgccaatgcaatggaaaaggaaacg
ggaaaaccattgaaatttttacgagtggatggtggtgccacttccaacgcatggctcatg
caattccaagctgacatcttaggaacaaaagtgatccgaccacaaaacgtggatacgacg
gtgctgggtgcggcatacttggcaggactcgaacgtggattttttaaatcagtggctcac
cttcgaaaagaagaaaccaaaaccacacaattcacaccgaagatgaaagaatccgaacgg
aaagaagaaattgataagtggaatttagccatttctcgtgtgaaaacggaaacctaa

DBGET integrated database retrieval system