KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1328Help
Entry
LBF_1328          CDS       T00712                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00071  Fatty acid degradation
lbf00280  Valine, leucine and isoleucine degradation
lbf00281  Geraniol degradation
lbf00310  Lysine degradation
lbf00360  Phenylalanine metabolism
lbf00362  Benzoate degradation
lbf00380  Tryptophan metabolism
lbf00410  beta-Alanine metabolism
lbf00627  Aminobenzoate degradation
lbf00640  Propanoate metabolism
lbf00650  Butanoate metabolism
lbf00903  Limonene and pinene degradation
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01120  Microbial metabolism in diverse environments
lbf01130  Biosynthesis of antibiotics
lbf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LBF_1328
   00650 Butanoate metabolism
    LBF_1328
  Lipid metabolism
   00071 Fatty acid degradation
    LBF_1328
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBF_1328
   00310 Lysine degradation
    LBF_1328
   00360 Phenylalanine metabolism
    LBF_1328
   00380 Tryptophan metabolism
    LBF_1328
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBF_1328
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LBF_1328
   00281 Geraniol degradation
    LBF_1328
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBF_1328
   00627 Aminobenzoate degradation
    LBF_1328
   00930 Caprolactam degradation
    LBF_1328
Enzymes [BR:lbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LBF_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABZ93848
Position
I:complement(1444362..1445195)
Genome map
AA seq 277 aa AA seqDB search
MNPSPFFTIERRKNVAILWLNRPEKRNAMNWPFWRDLPDMVAEIDADPKIHAFVIAGKGK
SFSTGLDLEEFFQDFKPVVQGEFADGREKLYQLILTMQKGINAVYNSKKPSIALVQKHCI
GGGLDLVSACDIRYASDDAVFSLRESKVAIVADMGSLQRLPHLIGNAHTRELALTGKDVT
ANEAFQMGLVTKVTKDFDSLLVEGLKTANEIAENPTIVIRGVKQVLNHGVGKTIEEGLDY
VAVWNASMLDSKDFRSAIGGFMERKRPVFNPETRVDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatctccattttttaccatcgaaagaagaaaaaacgtcgccatcctttggttg
aatcgtcctgaaaaacgaaatgccatgaactggcctttttggcgtgaccttccggatatg
gtggcagagattgatgctgatccgaaaatccatgcatttgtgatcgcaggcaaaggaaaa
tctttttcgacaggacttgatttggaggaatttttccaagacttcaaacccgtcgtccaa
ggggaattcgcagatggtcgagaaaaactttaccaactcattctcacgatgcaaaaagga
atcaacgctgtttacaattccaaaaaaccatcgattgcactagttcaaaaacattgtatc
ggtggaggactggatttggtatcagcctgtgacattcggtatgcatctgacgacgctgta
ttttccttacgtgaatccaaagtcgccatcgttgccgacatgggatccttacaaagactc
ccccatttgattggaaatgcacatacaagagagcttgccctcacgggaaaagacgttacg
gcaaatgaagcctttcaaatgggacttgtgacaaaggtcacaaaagactttgattcttta
ttggtagaaggtctcaaaacggcgaatgaaatagctgaaaatccaacaattgtaatccga
ggcgtcaaacaagtgctaaatcatggagtaggaaaaaccattgaagaaggtttggactac
gtggcggtttggaatgcaagtatgctcgattccaaagatttccgaagtgccatcggtggg
tttatggaacgaaaacgacctgtcttcaatccagaaacccgagtggacgattga

DBGET integrated database retrieval system