KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1371Help
Entry
LBF_1371          CDS       T00712                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1492918..1494639
Genome map
AA seq 573 aa AA seqDB search
MGSLIRVKQRRAGVLVSLPSIVSEHSFECGDIYSLYPLCDWAKDVGFSIIQLLPLNDTGF
GYSPYSAISAFAIDPLYISLYKMGQTTRSRKKEIKTLHNHPNRIRNEKIKIIRAHYESHQ
KEAQKEALQFLETQTWCYSYVTFRVLYETFEGKNWWEWPSEFQNLSSAKDYIFNEKREEA
LFWVYLQKIAYDQLCGVKLYCEDVGIFLKGDMPILTSRNSCDVWEHPDYFIMDLQAGAPP
DQFSATGQNWGFPVLNWDALEKNHYRWWKDRLTYLEHFFHLYRIDHVIGMYRIWAIPKED
KTAQKGWFHPQFGIETSEFLNVGINPKSMEEKGLIHEFKPNHYIFYWDFWKEESYQSLPE
ETKAKLFPLSQLHITAEEKHWREAGEKILEIFDSFSSMVPCAEDLGSVPSFIRDSLFERQ
MIGIDVVRWTKSFTTGEFIEEDNYRDNAISVLSTHDTSLVMDWWKHEGDLESKLQFFFDR
VGKPRPETEDQILEGLLEFVFQTKSIFSIQLFQDLALGISDVVENPEKHRINLPGTPDHS
NWTYRFPILIEEFANNFQRNFTIRKLVHSSGRI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ttgggatctttgattcgtgtcaaacaaagaagggcaggggtacttgtatctctgccctca
attgtttcagagcattcctttgaatgtggggacatttatagtttatacccactctgcgat
tgggcaaaagacgttggctttagcatcatccaattattaccattaaacgatacaggattc
ggatactcaccctatagtgccatctctgcttttgcgatcgaccctctttacatttcctta
tacaaaatgggacaaacgaccaggtctcgtaaaaaggaaatcaaaacattacacaaccat
ccgaatcgcattcgaaatgaaaaaatcaaaatcattcgtgcccattatgaatcgcatcaa
aaggaagctcaaaaagaagcattacaatttttagaaacacaaacttggtgttattcctat
gtgaccttccgcgttttgtatgaaacgtttgaaggtaaaaattggtgggaatggccaagt
gagtttcaaaacctttcctctgcaaaagattatatctttaatgaaaaaagagaggaagct
ctcttttgggtatacctacaaaaaatcgcctatgatcagttatgtggggtaaagttgtat
tgtgaagatgtgggaatatttttgaaaggggatatgccgattctcacctcccggaattct
tgtgatgtttgggaacacccggattactttatcatggacttacaggcgggtgcccctcca
gatcaattttctgccacaggacaaaactgggggtttcctgttctcaattgggatgcgtta
gaaaagaaccattaccgttggtggaaggataggcttacctatttagaacattttttccat
ctctatcgcattgaccatgtgattgggatgtatcggatttgggcgattccaaaggaagat
aaaacagcgcagaaaggttggttccatcctcaattcggaattgaaacgagtgaattttta
aatgtaggaatcaatccgaagtccatggaagagaagggcctcatccatgagttcaaaccc
aatcattatattttctattgggatttttggaaagaggaaagttatcagtcccttcctgaa
gaaaccaaggcaaaattattccctctctcccaattgcatatcacagcagaagaaaaacat
tggcgggaagcgggcgaaaaaatcttagaaatttttgattcgttttcatcgatggtgcct
tgtgcggaggatttgggttctgtgcccagtttcattcgtgattctttgtttgaaaggcaa
atgattggcattgatgtagtgcgttggaccaaatcctttaccactggggaattcatcgaa
gaggacaattatagggataatgcgatctctgttttatcgacacatgacacaagtttggtg
atggattggtggaaacacgaaggggacttggaatccaaacttcagtttttctttgacaga
gttggaaaaccaagacccgaaacagaagaccaaattttagaagggttactcgaatttgta
ttccaaaccaaaagtatctttagcatccaactctttcaggatttggcgctcggaatatcg
gatgtcgtcgagaatccagaaaaacaccgcatcaatttgcctggaacccctgaccattcc
aattggacctaccggtttcctatcctcatcgaagagtttgcaaacaacttccaaaggaat
tttactatacggaaactcgtccattcttcaggtagaatttag

DBGET integrated database retrieval system