KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1442Help
Entry
LBF_1442          CDS       T00712                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBF_1442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_1442
   00052 Galactose metabolism
    LBF_1442
   00500 Starch and sucrose metabolism
    LBF_1442
   00520 Amino sugar and nucleotide sugar metabolism
    LBF_1442
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBF_1442
   00524 Butirosin and neomycin biosynthesis
    LBF_1442
Enzymes [BR:lbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBF_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1562168..1563064)
Genome map
AA seq 298 aa AA seqDB search
MRQAIGVDIGGGSIRVSLFDENGSELDSHHTKTPEHLDNDSFLEVLVESIRPLVKNIIGI
GVGSPGPLNNETGVMLTSANMAGLKNLPIKSVLQKEFSLPVFYENDANCAALGEAIFGTY
KNTESQLILTLGTGIGGGFVKQGKLYTGYLGNGIEIGHTTSVIGGALCGCGVHGCVESYF
STKGFLNRYFEKTNTKLPNAEAFFSLVRSNDSESKSILEFGTKALAHAVRNAIQLLNPEA
VIFVGGITKSYDLFGALLEKEIRSTIFSVLNDRLLLGPGGNISGTLGAASLVFVKEKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaagcgattggtgttgatattggtggaggaagcatccgcgtttctctttttgat
gaaaatggaagtgaactagactcccatcacaccaaaacccctgaacacttagacaatgat
tcctttttagaagtactggtcgaaagcattcgcccacttgtaaagaatatcattggaatt
ggtgttggttcccctggccctctcaataacgaaacgggcgttatgctgacaagtgccaat
atggcaggtcttaagaacttacccatcaaatcagttttacaaaaagaattttcacttcca
gtattctatgaaaacgacgccaactgtgctgcattaggtgaagctatctttggaacgtat
aaaaacaccgaatcacaattaattttgacattaggaacagggattggtggagggtttgtc
aaacaaggtaaactttatacgggataccttgggaatggaatcgaaattggccataccact
tctgtcatcgggggcgccttgtgcggatgcggagttcacggttgtgtggagagttatttt
tccacaaaaggatttttaaaccgttattttgaaaaaaccaataccaaactccccaatgca
gaagcctttttttcactcgttcgatcgaatgattcagaatcaaaatccattttggaattt
ggaaccaaagctttagcacacgcagttcgtaatgcgatccaattactcaacccagaagcg
gtcatttttgtgggtgggatcaccaagtcctatgatttgtttggtgcacttttagaaaaa
gaaattcgatctacaatcttttctgtattaaacgatcgattattacttgggcctgggggc
aatatatcaggaactctgggtgccgcctcacttgtttttgttaaggagaaaaactga

DBGET integrated database retrieval system