KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1505Help
Entry
LBF_1505          CDS       T00712                                 

Gene name
acoC
Definition
bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBF_1505 (acoC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_1505 (acoC)
   00020 Citrate cycle (TCA cycle)
    LBF_1505 (acoC)
   00620 Pyruvate metabolism
    LBF_1505 (acoC)
Enzymes [BR:lbf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBF_1505 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1629528..1630919)
Genome map
AA seq 463 aa AA seqDB search
MAKIQEMTQLSPTMEEGTIVKWLKNEGDAISPGDILAEVETDKAVMEMEAYDAGVILKII
QQEGTKLRVGEAMAIIGKPGEDISSLLSNLPKKETQAKGPNPTSPSPSGEVSSESGANGN
DRAITQEKAIQEKQTLETPTEAQFPVAQGSAIPTKNSSSSQKPLPLSNIPRGSLRVLASP
LAKSIAIEHGIDLHQVLGTGPEGRITKKDVLDSLNKGFRPSSFDSDKMSQDEVVSLNGMR
KTIAKRLTESKQNLPHFYLNVDINAKALESFRKEINDFQTSQNPDSANKVSLNDIIVKAT
AAALKLHPKVNASFQGDSILQFGRVDVGIAVSIDGGLLTPVIRDANRKSILEISKEVKEL
AKKARDRKLKPEEFTNGTFTISNLGMYGISRFTAIINEPEGAILAVGSAEDKPVVENGVV
VAGRVISLTLSCDHRVIDGAVGAEFLKTLRSFLEKPNLLLAVG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatccaagaaatgacccaattatctcctaccatggaagaaggaaccattgtt
aagtggttgaaaaatgaaggggacgcaatcagtccaggtgacatcctagcagaagtcgaa
accgataaagctgtgatggagatggaagcctatgatgcaggtgtgatccttaaaatcatc
caacaggaaggcaccaaactgagagttggtgaagccatggcaatcattggaaaacctgga
gaagacatctcctccctcctttccaatcttccgaaaaaagaaacgcaggcaaaaggccca
aatcccactagtccctccccatccggggaagtaagttccgaatcgggagctaatggaaat
gatcgagctatcacccaagaaaaagccatacaagaaaaacaaaccctagaaacacctacc
gaagcccaatttccagtggctcaaggatcagccattcctacaaagaattcaagttcgtcg
caaaaacctctgcctctttccaacattccaagaggatccctccgtgtacttgcctctcct
cttgccaaatccatcgccatcgaacatggaatcgatttgcaccaagttttgggaactggc
ccggaaggtaggatcaccaaaaaagatgttctggattccttaaacaaaggttttcgtcca
tcgagttttgattctgacaagatgagccaagatgaagtggtcagtttgaatggaatgcgg
aaaaccattgccaaacgactcacagaatccaaacagaacctcccccatttttatttgaat
gtggatataaatgccaaagcactggagtccttccgaaaggaaattaacgacttccaaacc
tcacaaaatccagattcggcaaataaggtgagtttgaatgacatcattgtcaaagcaacc
gcggccgcactcaaactccacccaaaagtcaatgcgagtttccaaggagattctatctta
caatttgggagagtggatgtagggattgctgtctccattgatggcggtctattaacgcct
gtcattcgagatgcgaatcgaaagtccatcttagaaatttcaaaagaagtgaaggaactc
gccaaaaaagcaagggatcgaaagttaaaaccggaagaatttaccaatggaacctttacc
atttccaatttagggatgtatgggatcagtcggtttacggcgatcatcaacgaaccggaa
ggagccatcctggctgtaggttctgcagaagacaaaccggttgtggaaaacggagttgtg
gtagcgggaagggtaatttccctcacactctcctgcgatcatcgtgtgatcgatggagct
gtgggagcagagtttctaaagaccttaaggagctttttggaaaaaccaaacctactcctt
gcagtcggttaa

DBGET integrated database retrieval system