KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1505Help
Entry
LBF_1505          CDS       T00712                                 

Gene name
acoC
Definition
bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lbf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbf00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lbf00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lbf00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1629528..1630919)
Genome map
AA seq 463 aa AA seqDB search
MAKIQEMTQLSPTMEEGTIVKWLKNEGDAISPGDILAEVETDKAVMEMEAYDAGVILKII
QQEGTKLRVGEAMAIIGKPGEDISSLLSNLPKKETQAKGPNPTSPSPSGEVSSESGANGN
DRAITQEKAIQEKQTLETPTEAQFPVAQGSAIPTKNSSSSQKPLPLSNIPRGSLRVLASP
LAKSIAIEHGIDLHQVLGTGPEGRITKKDVLDSLNKGFRPSSFDSDKMSQDEVVSLNGMR
KTIAKRLTESKQNLPHFYLNVDINAKALESFRKEINDFQTSQNPDSANKVSLNDIIVKAT
AAALKLHPKVNASFQGDSILQFGRVDVGIAVSIDGGLLTPVIRDANRKSILEISKEVKEL
AKKARDRKLKPEEFTNGTFTISNLGMYGISRFTAIINEPEGAILAVGSAEDKPVVENGVV
VAGRVISLTLSCDHRVIDGAVGAEFLKTLRSFLEKPNLLLAVG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatccaagaaatgacccaattatctcctaccatggaagaaggaaccattgtt
aagtggttgaaaaatgaaggggacgcaatcagtccaggtgacatcctagcagaagtcgaa
accgataaagctgtgatggagatggaagcctatgatgcaggtgtgatccttaaaatcatc
caacaggaaggcaccaaactgagagttggtgaagccatggcaatcattggaaaacctgga
gaagacatctcctccctcctttccaatcttccgaaaaaagaaacgcaggcaaaaggccca
aatcccactagtccctccccatccggggaagtaagttccgaatcgggagctaatggaaat
gatcgagctatcacccaagaaaaagccatacaagaaaaacaaaccctagaaacacctacc
gaagcccaatttccagtggctcaaggatcagccattcctacaaagaattcaagttcgtcg
caaaaacctctgcctctttccaacattccaagaggatccctccgtgtacttgcctctcct
cttgccaaatccatcgccatcgaacatggaatcgatttgcaccaagttttgggaactggc
ccggaaggtaggatcaccaaaaaagatgttctggattccttaaacaaaggttttcgtcca
tcgagttttgattctgacaagatgagccaagatgaagtggtcagtttgaatggaatgcgg
aaaaccattgccaaacgactcacagaatccaaacagaacctcccccatttttatttgaat
gtggatataaatgccaaagcactggagtccttccgaaaggaaattaacgacttccaaacc
tcacaaaatccagattcggcaaataaggtgagtttgaatgacatcattgtcaaagcaacc
gcggccgcactcaaactccacccaaaagtcaatgcgagtttccaaggagattctatctta
caatttgggagagtggatgtagggattgctgtctccattgatggcggtctattaacgcct
gtcattcgagatgcgaatcgaaagtccatcttagaaatttcaaaagaagtgaaggaactc
gccaaaaaagcaagggatcgaaagttaaaaccggaagaatttaccaatggaacctttacc
atttccaatttagggatgtatgggatcagtcggtttacggcgatcatcaacgaaccggaa
ggagccatcctggctgtaggttctgcagaagacaaaccggttgtggaaaacggagttgtg
gtagcgggaagggtaatttccctcacactctcctgcgatcatcgtgtgatcgatggagct
gtgggagcagagtttctaaagaccttaaggagctttttggaaaaaccaaacctactcctt
gcagtcggttaa

DBGET integrated database retrieval system