KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1707Help
Entry
LBF_1707          CDS       T00712                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lbf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lbf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1844031..1845557)
Genome map
AA seq 508 aa AA seqDB search
MKLTEIIKKIPELKLIKGDGDLDVGYIWADSRKLKPNDVFVLPEDKAETIESYLQMAYDK
GVKVVLVSKRNLKLKNLDLFPTILESEDALGDVHGKMASQLLGNPSKKLKIIGITGTNGK
TSLTFILFHIAKKLKKKVALIGTVQIQILDRILESGYTTPDASSLNLLLREMLDEGVEYV
FMEISSHGLKLGRVAGIEITCAGFTNLTQDHLDFHESMEDYFESKFKIFQLLEQSSVKNK
FGLVAGDVSFGDRMIQRIRESKLKTPIYILGKSGEFHYSNTKLSLLGSEYRFHKKEKNLP
FIEVRSIRTNLLGNFNVFNTAFAMSIAYELGFPWDEVVTAIEEIPTVPGRFQVIPYPDKT
RIAVVDYAHTPDALENILKSCVEIRPKQLICLFGCGGDRDRTKRPQMAKIAETLADFVFL
TSDNPRTEDPESILDEIESGFSRGFKRYEKITDRRVAIQRAVSLLEKDGILVVAGKGHET
YQIIGKEKTNFVDFLEIENAFLNLDTGL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaactgaaattatcaaaaaaattcctgagctcaaactcatcaaaggagatgga
gatttagacgtaggatacatctgggcagatagccgaaagctgaaaccaaatgatgttttt
gtactaccggaagacaaagctgagacaatcgagtcttatttgcaaatggcttacgataaa
ggtgtcaaagtggttcttgtatccaaacggaacctcaaattaaaaaatctagatttattt
ccgaccatactcgaatcagaagatgcgttaggtgatgttcatggaaaaatggcatcacaa
ctcttagggaacccatctaaaaaattaaaaatcattgggatcactggcacaaatggaaaa
acatctttaacttttattttattccacattgccaaaaaattaaagaaaaaagttgcactc
ataggtactgtccaaatccaaattttagaccgaattttagaatcaggttataccacacca
gatgcatcttctctcaatttattactcagagagatgttagacgaaggtgtagaatatgtt
tttatggagataagtagccatggattaaaattgggaagagtggcaggaatcgaaatcacc
tgtgctggtttcaccaatttaacccaagaccatttagactttcatgaaagtatggaagac
tattttgaaagtaagtttaaaattttccaactcctcgaacaatcgtcagtcaaaaacaaa
tttggtttggttgcaggtgatgtttcatttggtgatcgaatgatccaaagaatacgcgag
tcgaaattaaaaactcccatttatattcttggcaaatcgggtgaattccattatagcaat
acaaaactctctcttcttggaagcgaataccgtttccataaaaaagaaaaaaatcttcct
tttattgaagtcagaagcattcgcaccaatttactcggaaacttcaacgtgtttaatact
gcctttgccatgtccattgcttatgaacttggatttccttgggatgaggttgttacggcg
atcgaagaaattcccactgtacctggacgttttcaagtcatcccataccctgacaaaact
cggatcgccgttgtggattatgcacacactcctgatgcgttggaaaatattctgaagagt
tgtgttgaaattcgtcccaaacaactcatctgtttgtttggttgtggcggtgatcgggat
cgtaccaaacgaccacaaatggcaaaaattgcagaaaccttggctgattttgttttcctg
acttccgacaatccaagaactgaggatcctgagtccatcttggatgaaatcgaatcaggt
ttttctcgtggtttcaaacggtatgagaagatcactgaccgaagggttgccattcagcga
gcagtttcccttttggaaaaagacggcattttggtcgttgcaggaaagggacacgaaact
taccaaatcatcggcaaagaaaaaaccaattttgtcgactttttagaaattgaaaatgcg
tttttaaatttagataccgggttatag

DBGET integrated database retrieval system