KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_2028Help
Entry
LBF_2028          CDS       T00712                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBF_2028 (tpiA)
   01230 Biosynthesis of amino acids
    LBF_2028 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_2028 (tpiA)
   00051 Fructose and mannose metabolism
    LBF_2028 (tpiA)
   00562 Inositol phosphate metabolism
    LBF_2028 (tpiA)
Enzymes [BR:lbf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBF_2028 (tpiA)
Exosome [BR:lbf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBF_2028 (tpiA)
  Exosomal proteins of bladder cancer cells
   LBF_2028 (tpiA)
  Exosomal proteins of melanoma cells
   LBF_2028 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2182442..2183191
Genome map
AA seq 249 aa AA seqDB search
MRKKIIAGNWKMNLTLAEAKEITKGLLSACDSSSYEIMVFPSALHLESVASIARDSQLIV
GAQNAYQSGLTAMTGEISPVQLAELGIQTVLVGHSERRQFLGETSEFDNTKISYFLKHGL
RVVYCVGETWAEREKGNTFSVLEDQIGKGLKGITSDLFKNLVIAYEPVWAIGTGKVATPV
EAEEAHAFIRKEIGKLFVGADLVAENIQILYGGSVKPDNIKELLAKPNIDGGLVGGASQK
LDLFLGLLK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaagatcatcgcagggaattggaaaatgaacctcacgctagcggaggcaaaa
gaaatcaccaaaggtttactctcggcttgtgactcttcttcttatgaaatcatggtcttc
ccgagtgccctccatttggagtcagtggcatccattgcccgagactcccaactcatcgtg
ggggcacaaaatgcctaccaatcggggcttaccgccatgacaggtgaaatctccccagtc
cagctggcagaactgggcatccaaaccgttcttgtgggccactcggaaaggagacaattc
ctcggagaaacatccgaatttgacaataccaaaatctcctacttcttaaaacatggacta
cgagttgtctattgtgtcggggaaacttgggccgaacgagaaaaaggaaacaccttttct
gtgttagaggaccaaattggcaaaggattaaaagggatcacaagtgaccttttcaaaaac
ctcgtgattgcctatgaaccagtttgggccattggaacgggaaaagtagcaactcccgta
gaagcggaagaagcgcatgcctttatccgaaaagaaattggcaaattatttgttggtgca
gaccttgtggcggagaacattcaaattctttatggtggttcagtcaaacctgacaacatc
aaggaacttctcgccaaaccaaatattgacggtggcctcgttggtggagccagtcaaaaa
ttggatttatttttaggacttttaaaataa

DBGET integrated database retrieval system