KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_2527Help
Entry
LBF_2527          CDS       T00712                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00260  Glycine, serine and threonine metabolism
lbf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01130  Biosynthesis of antibiotics
lbf01230  Biosynthesis of amino acids
Module
lbf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBF_2527 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBF_2527 (trpA)
Enzymes [BR:lbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBF_2527 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA His_biosynth PurA
Motif
Other DBs
NCBI-ProteinID: ABZ95011
UniProt: B0SDM7
Position
I:complement(2705067..2705867)
Genome map
AA seq 266 aa AA seqDB search
MSKIKELFESGKFKSAFIPYFTLGDPNYNDSIEFGKTILDGGADILELGIPFSDPVADGP
VIQRAVARSLKNKFSFDEIFRVTKQIHLHKQETPLVYLTYFNPIYHCGITKFLDNAKDSG
VVGLVIPDLPFDTIESETLFQELRLRDMDLIHLVTPASTKKRIEALRKTSTGFIYYVTSF
GVTGERREFSVDLKERIRFLKDTIQLPICAGFGISTPEQASQIAGYADGIIIGSAIQRVI
EENGQDASKAKNVLADYITKIRASIS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaagaactttttgaaagtgggaaatttaaatccgcatttattccttat
tttacattgggtgatccaaactacaatgattccattgagtttgggaaaaccatcttagat
ggaggagccgacattttagaattaggaattcctttttcagatcctgtggcggacggtccc
gtgatccaaagggcggtggcacgttctttaaaaaacaagttttcttttgatgaaattttt
cgtgtcaccaaacaaatccatcttcataaacaagaaaccccacttgtgtatctcacgtac
tttaatcccatctatcattgtgggattacaaagtttttggataatgcaaaagattcgggt
gttgtgggacttgtgattcccgatttgccttttgacacaatcgaaagcgaaacacttttc
caagaattaagacttagggatatggatttaattcatctcgtcacaccagcatcgaccaaa
aaacgaattgaagctctaaggaaaacatctacaggatttatctactatgtgacttccttt
ggtgtgacaggagagcgccgtgagttttctgtcgacttaaaggaaaggattcgtttctta
aaagatacgatccaacttcccatttgcgctggatttggaatctccacccccgaacaagca
agtcaaattgccgggtatgcggacggaatcatcatcggatctgccatccaaagggtcatc
gaagagaatgggcaagacgcttccaaagcaaaaaatgttttggcggactacataacaaag
attcgggcatcaatttcctaa

DBGET integrated database retrieval system