KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_3332Help
Entry
LBF_3332          CDS       T00712                                 

Gene name
acsA
Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00010  Glycolysis / Gluconeogenesis
lbf00620  Pyruvate metabolism
lbf00640  Propanoate metabolism
lbf00680  Methane metabolism
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01120  Microbial metabolism in diverse environments
lbf01130  Biosynthesis of antibiotics
lbf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_3332 (acsA)
   00620 Pyruvate metabolism
    LBF_3332 (acsA)
   00640 Propanoate metabolism
    LBF_3332 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LBF_3332 (acsA)
Enzymes [BR:lbf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LBF_3332 (acsA)
Lipid biosynthesis proteins [BR:lbf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LBF_3332 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABZ95798
UniProt: B0S8X7
Position
I:complement(3578628..3580592)
Genome map
AA seq 654 aa AA seqDB search
MPKERIVAPSKEFAKLANVSLKEYKSKYKESIEKPEKFWAEQAKRLTWFKKWTKVLRHDF
AKAKVEWFVGGKLNVSYNCLDRHLDSPLKNKAALIWEGDNPDESKVLTYHDLHREVNHFA
NVLKKFKVKKGDRVLIYLPMVPELAIATLACTRIGAVHSVVFGGFSPEALLGRIEDCKPT
LVITADGGYRGGKPIELKKNVDAALAETKFKVNDVIVVKRTGDEGNLNWKEGRDHWYHYL
MKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANLTFATIFDYKDT
DTYWCTADIGWITGHSYILYGPLSNGATSLMFEGVPSYPDMGRFWDVIDKYKVTVFYTAP
TAIRALMREGLEHIKKRSLASLRLLGSVGEPINPEAWEWYYANIGKSKCPIVDTWWQTET
GSIMISGIPGAIPQKPGSASWPFYGIQPVLVDNEGVELKGKGEISGNLCIAKPWPSMMRG
VYGDPKRFFDTYFSQFKGYYFTGDGANRDKEGYFRITGRVDDVLNVSGHRIGSAEVESAL
VEHKSVAEAAVVGFPHDIKGQGIYAYVTVKQGVVTNDLLKKELIAMVEKVIGKIARPDVI
HWAPGLPKTRSGKIMRRILRKIANNEFDTLGDISTLADPSVVQSLIDDKKKYHS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagaaagaatcgtggcaccatccaaagaatttgccaaacttgcaaacgttagc
ttaaaagaatacaaatccaaatacaaagaatccattgaaaaaccagagaaattttgggca
gaacaagcaaaacgcctaacatggtttaaaaaatggaccaaagttctgagacacgacttt
gcaaaagcaaaagtagaatggtttgtggggggaaaactcaatgtctcttataattgttta
gaccgccaccttgactctcccttaaaaaacaaagccgctctcatatgggaaggtgacaat
cccgacgaatccaaagtcctcacctatcacgacttacatagagaagtgaatcactttgcc
aatgtactaaaaaaattcaaagtgaagaaaggagaccgagttctcatctaccttccgatg
gtcccagaacttgccatcgccacacttgcttgtactcgcatcggggccgtgcattccgtt
gtctttgggggattttctccagaagcactccttggtcgtatcgaagattgtaaaccaact
cttgtcatcacagccgatggtggataccgtggtggcaaacccatcgaactgaaaaaaaat
gtcgatgctgccctcgctgaaaccaaattcaaagtgaatgatgtgattgtcgtcaaacga
acgggtgatgaaggcaatctcaattggaaagaaggtcgtgaccattggtatcactacctc
atgaaagaccctgaagtgaaaaaagaatgccccgctgttcctatggaatcggaagaccca
ctcttcatcctttacacatctggttccacgggaaaaccaaaaggggtcctccataccacc
gccgggtatttgttaggtgccaatctaacattcgctactatctttgattacaaagacacg
gatacatactggtgtacggcagacattggttggatcacgggtcatagttatatattgtat
ggaccactctccaatggtgctacttccttgatgttcgaaggggttccgagttaccctgac
atgggtcgattttgggatgtgattgataaatacaaagtcaccgtattttataccgcaccg
acggccattcgggcactcatgcgagaaggtctagagcatatcaaaaagcgatcactcgca
tcactgcggttacttggttctgtgggagaacccattaacccagaagcttgggaatggtat
tatgctaatattggaaaatcgaaatgcccgattgtggatacatggtggcaaacagaaact
ggatccattatgatctcagggattccgggagccattccgcaaaaaccaggatcggccagt
tggccattttatggaatccaaccagtacttgtggacaacgaaggggtggaactgaaaggc
aaaggtgaaatttcaggcaatctttgtatcgcgaaaccttggccttcgatgatgcgcgga
gtgtatggagatccgaaacgattctttgatacctacttctctcaattcaaaggctattat
ttcacaggggatggggccaatcgtgataaagaaggatactttcgcatcacagggcgagtc
gatgatgtcctcaatgtctcagggcatcggattggatcggcagaagtggaaagtgccctt
gtggaacacaaatcggtggcggaagcggctgttgtgggtttcccacatgacatcaaaggc
cagggaatttatgcctatgtcacggtgaaacaaggggttgtcacaaacgacctactgaaa
aaagaactcattgcgatggtggaaaaggtgattggaaaaatagcgaggccagatgtgatc
cattgggccccaggacttcctaaaactcggtctggtaaaatcatgcgtcgaattttacgg
aagattgccaataacgaatttgatacgttaggtgacattagtacacttgccgatccatcc
gttgtccaatcgttaattgatgataagaagaaataccatagttaa

DBGET integrated database retrieval system