KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_3333Help
Entry
LBF_3333          CDS       T00712                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3580676..3581227)
Genome map
AA seq 183 aa AA seqDB search
MENLIEEILKQIGEDPNREGLVKTPNRVKKAYDFLTSGYKADINQLVNGAIFEENTTGMV
LVRDIEMYSLCEHHLLPFYGRAHVAYIPNKKIIGISKIPRIVDVFARRLQVQERLTDQIA
QAIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLFKTDPTTRSEFLDLIRT
GSH
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttaatcgaagaaatcctaaaacaaattggtgaagatccaaacagagaaggt
ctcgtcaaaactcctaatcgagtgaaaaaagcttatgattttttaacgagtgggtacaag
gcagacatcaaccaattggtcaatggcgccatttttgaagaaaataccacaggtatggtt
ttggttcgtgatattgaaatgtattccttatgcgaacaccacttactccctttttatgga
agggctcatgtcgcatacattcccaataaaaaaatcattgggatcagtaaaattccacga
atcgtagatgtgtttgccagaagactgcaagtacaagaaagacttaccgaccaaattgca
caggccatccaagaaacattggaccctttgggtgttggtgttgtcatcaaagcaaaacat
ttgtgtatgatgatgcgaggagtcgaaaaacaaaactcagaattattcacttccagtttg
cttggtctcttcaaaacggatcctactactcgaagcgaatttttagatctcatccgaacc
ggatcgcactaa

DBGET integrated database retrieval system