KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_3348Help
Entry
LBF_3348          CDS       T00712                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBF_3348 (recR)
DNA repair and recombination proteins [BR:lbf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LBF_3348 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3589851..3590459
Genome map
AA seq 202 aa AA seqDB search
MEGSHLSDPQFQKLIQAFSSLPGIGKKSATRIGFHILRMDPSTFQSWINHIEEAKTKLRF
CDDCGGLTEDSICSICLSDRRDNGILCVVEQPEDIFFIENTKEYSGKYHVLNGAISPLDG
IGPEQLRIKQLMQRLDIGNIKEVLIATNPTLEGDATASYLSTVIKPMEIKITRIAHGITI
GGTLEYSDQYTLGKAIKSRLTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagggttcccacctgtctgatcctcaattccaaaaactcatccaagctttttcgagc
ctacctggaatcggaaaaaaaagtgcaactcgaattggatttcatatcttacgtatggat
ccatctaccttccaatcttggatcaatcatatcgaagaagcaaaaaccaaacttcgattt
tgtgatgactgtggtggattaacagaagattcgatttgttcgatttgtttgtcagacagg
cgagataatggaattttatgtgtcgtggaacaaccagaagatattttctttatagaaaac
acaaaggaatactccggtaaataccatgttctaaatggtgctatctcaccattggatgga
attggaccagaacaattacgtatcaaacaattgatgcaacgtttggatataggaaatatc
aaagaagtattaattgctacaaatcctactcttgaaggggacgcaactgcatcttatcta
tcgacagtcattaaaccaatggaaattaaaatcacaaggatagctcacgggattactatt
ggtggaacgttggaatattccgaccaatacactttaggtaaggcaattaaatcgagactg
acgttgtaa

DBGET integrated database retrieval system