KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_4172Help
Entry
LBF_4172          CDS       T00712                                 

Gene name
pfkA
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBF_4172 (pfkA)
   01230 Biosynthesis of amino acids
    LBF_4172 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_4172 (pfkA)
   00030 Pentose phosphate pathway
    LBF_4172 (pfkA)
   00051 Fructose and mannose metabolism
    LBF_4172 (pfkA)
   00052 Galactose metabolism
    LBF_4172 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LBF_4172 (pfkA)
Enzymes [BR:lbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBF_4172 (pfkA)
Protein phosphatases and associated proteins [BR:lbf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBF_4172 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(176188..177495)
Genome map
AA seq 435 aa AA seqDB search
MNENDTKVEQFGPCTFPNPAGYDYWTEDNSVVLFQTIFSGPDDAKKTIETSPVFFEQAGP
KEKIYFRPEEVTAGIVTCGGLCPGINDVIRALVMELHYRYKVPRILGFPFGYEGLVKKFG
HRPIELTPDKVAHIMNFGGSILGSSRGNQKIEEMVDTLFLYGVKMLFCIGGDGTLRGAQA
IQEEVKKRKEDIAIVGIPKTIDNDINYVQKTFGFSTAFSKAVEAVNCAHEEAKGAPNGIG
LVKLMGRHSGFIAVNSALASKNVNFVLIPELDFDLEGEGAFLPVLKDRVQRRGHAVVIIA
EGAGQKYFEDKGEKDRSGNKKLADVGVYIKDKITEYFQKEGVALNLKYIDPSYIIRSVPA
NAEDSVFCGFLAQNAVHAAFAGRTGCVVGIWNNVFTVMPISLAIAERKVLRPERSTLWRA
LLASTGQPNSMKAKV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgatacaaaagtagaacaatttggaccttgtaccttcccaaacccagcg
gggtatgactactggacagaagacaattcggttgtgctcttccaaaccatcttttctgga
ccagacgatgcaaaaaaaaccatcgaaacaagtcccgttttctttgaacaagccggtccg
aaggaaaaaatctactttcgacccgaagaagtgacagcagggatcgttacctgtggggga
ctttgccctgggatcaatgatgtgatccgagcacttgtgatggaattgcactatcgttat
aaagtaccgaggatcctcggattcccttttgggtatgaagggttagtgaaaaaatttgga
cataggcccattgaactcactcctgataaggtggctcatatcatgaattttggtgggtcc
atccttgggtcttccaggggcaatcagaagattgaagagatggtcgatactttgttttta
tatggtgtgaagatgttgttttgtatcggaggggacgggaccttacgcggagcccaagcc
atccaagaagaagtgaaaaaacgaaaggaagacatcgccatcgtaggcattcccaaaacc
atcgacaacgatatcaattatgtccaaaaaacatttggattttcgacagcctttagtaag
gcggtggaagctgtgaactgcgcccatgaagaagcaaaaggagcaccgaatgggattggt
cttgtgaaactgatggggcgccactccggattcattgctgtgaattctgctttggcttct
aagaatgtaaactttgtcctcatccctgaacttgattttgatttagaaggagagggtgct
tttctgcctgttttaaaagacagagtgcagagacgaggccatgcggttgtcatcatcgcc
gaaggggcagggcaaaagtacttcgaagacaagggagaaaaagatagatcgggtaacaag
aagttggcggacgttggtgtatacatcaaagataaaatcaccgaatactttcaaaaagaa
ggtgtggcactgaatctaaaatacattgacccgagttacatcattcgttccgtgcctgcc
aatgcggaagattccgtgttttgtggattcctagctcaaaatgccgtgcacgctgcgttt
gcaggtcgtacaggatgtgtggtcgggatttggaacaatgtgtttacggtgatgcccatt
tctttggcgattgcagaacgaaaggtacttaggccagagcggagtacgttatggcgagca
ctccttgcttccacgggccaaccgaattcgatgaaggcgaaagtttaa

DBGET integrated database retrieval system