KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_5018Help
Entry
LBF_5018          CDS       T00712                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lbf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p74:complement(16746..18548)
Genome map
AA seq 600 aa AA seqDB search
MKVIDEKIQSFLNSLYKLFPDWDTSLKDTIASLLVQSQSGDLYLPITDDTTIDKMKDYFP
FVIERTGKENRLYLQKSHSEKRNFESLLFTFLNHKTNQTKNTTITADQIKTIISGLETES
KIKLAEEQRETIQDVITSNFRVISGGPGTGKTTVVSFILMAFDRLKLLPSMERIALVAPT
GRASQRLTESIQRNLEKFQADPSLTSNFRGQTIHNLLKINPTTNQAKFGEKRYLPYDFII
MDETSMVDLKLMNLFFSAIHFDTHIILLGDPNQLPSVGQGEVLTDLITTLKNKKEFLSEL
NSNHRFSNDSEFSVFAEIVKQSFDTNSNTKPFPLPKMITKSDLNLKHDFVWIQGDKKTKS
TNGNHPEIHDWNIESMVPFLWETFYLHTANKTSKFHWEPNALKDPKNKFIFESIVNEYRC
LTILRNGYFGIEAIQGQILRYAKKQLTNPKNEFHLKYRQLSKSFYFEGMPIIIQSNDPMR
KLFNGDIGLVVSIHSELRAVFPIEDRLYSFALDTLPDHEPAFFLTIHKSQGSEYKSILLY
LPPMNVLDVDSENNLSILNRRILYTAITRAKERVILLGDFQTWEFGLQSFRKRYTGIHIP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgatcgatgaaaaaatccaatcgtttctaaattcgttatacaaacttttccca
gattgggatacgtcgctaaaagatacgattgccagtttacttgtccaatcacaaagcgga
gatttgtatcttcccataacagatgacacaacaatcgataaaatgaaagattatttcccg
tttgtgattgaaagaacaggaaaagaaaaccgattgtatctgcaaaaaagtcattccgaa
aaaaggaatttcgaatctctactcttcacattcttaaaccacaaaacaaaccaaacaaag
aatacaacgatcaccgcagatcaaatcaaaacgattataagtggtttagaaacagaatca
aaaatcaaactggcagaagaacaaagggaaacgattcaagatgtgatcacatccaatttc
cgtgtgatctctggtggcccagggacaggaaaaactacggttgtatcctttatcttaatg
gcattcgatcgattgaagttactaccttcgatggaaaggattgccctcgtcgcgccaaca
ggaagagcttcgcaaagattaacagaatccatccaaaggaatttggaaaagtttcaagcg
gatccttctctgacttccaatttccgtggacaaaccattcacaatttattaaaaatcaac
ccaacaaccaaccaagccaaatttggagaaaaacgttatctaccctatgatttcatcatc
atggatgaaacctcgatggttgatttaaaattaatgaatttatttttttcggcgatccat
ttcgatactcatatcattctcctcggtgacccaaaccaacttccttccgttgggcaaggt
gaagtattaacggatctcatcaccacgttaaaaaataaaaaagaatttttatcggaactt
aacagtaaccatcgtttttcgaatgattctgaattcagtgtttttgctgagatcgtaaaa
caatcctttgatacgaatagcaatacaaaaccatttccactaccaaagatgatcacaaaa
tcggatttgaatttgaaacatgattttgtttggatccaaggtgacaaaaaaacaaagtca
accaatggaaaccatcctgagatacacgattggaacatagaaagtatggttcccttttta
tgggaaacattctatttgcacactgccaataagacctcaaaattccattgggaaccaaat
gcactgaaagatccaaaaaacaaattcatttttgagtcgatcgtgaatgagtatcgatgt
ttgacgattctaagaaatggatactttggaatcgaagccatccaaggccaaatcttacgt
tatgcgaaaaaacaattaaccaatccaaaaaacgaattccatctcaaataccgacagtta
tccaagtctttttactttgaagggatgcccattatcatccaatcgaatgacccaatgaga
aaattgtttaatggtgacattggtttagttgtttcgatccattcagagttaagagcagtt
ttccccattgaagatcgattgtattcctttgccttagacacactccctgatcacgaaccc
gctttttttctcaccattcacaaaagccaaggttccgaatacaaatcgatcctactctat
cttcctccgatgaatgttttggacgtagattcagagaacaatctttccatactcaaccga
aggattttgtacacagcaatcactcgcgccaaagaacgcgtgatcttacttggtgacttt
caaacttgggaatttggattacaatcgtttcgcaagcggtatacaggaattcacattcca
tag

DBGET integrated database retrieval system