KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0249Help
Entry
Lbuc_0249         CDS       T01477                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lbuc_0249
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lbuc_0249
   00600 Sphingolipid metabolism
    Lbuc_0249
Enzymes [BR:lbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Lbuc_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267345..269570
Genome map
AA seq 741 aa AA seqDB search
MAIRIEDQNLLFHLQTDHTSYIFHMMENGELGQIYYGKRVHSKPSYDNLVTREWHNAAAV
WRLDHKDVQPQVLKQEYASLGKGDFRYPAYQVAQANGSRITEFKYESYELVDGKQRLAGL
PSAFDDTDDDAQTLTIALRDKLLGLVMHLNYTIFPHQDVIVRSAEFQNQGNEKLRLNSAA
SAQLDLPDADYDFIQFSGAWARERHMIRTHLRSGVQSVGSLRGTSSHQQNPFVMLARPNT
DDAQGSVFGFNLIYSGNFSDQVQVDQYDASRVLVGINPEEFAWNLKPGDKFQTPEAVLSY
TDAGMNQLSQQMGAFYQDHLVNPRFAHEQRPTLINNWEATFMDFDEDKLLSFATTAKKLG
LEMFVLDDGWFGHRNNDDSSLGNWFVNEPKFPSGFGTFTQKIHDLGLKFGLWFEPEMISI
DSELYKQHPDWLINAPGRHASPERQQFVLDMTRSEVVDYLFDAMSKIIEMTKLDYIKWDM
NRNITETYSSQLSADDQLEVPHRYILGVYQLYDRLVKAYPDVLFESCSSGGGRFDLGMMY
YAPQAWTSDDTDAVERMLIQFGTSYGYPQTMMGAHVSAVPNDQVGRITSLKTRANVAYFG
DFGYELDITKMSPEEQQQVKEQTAFYKEHRQLFQFGKFYRIDNPFANGGNVMSWEVVSDD
QKHAIAARYQILNRPNTGYIRLYLKGLDPDTKYTVNGGSEQFYGDELMNAGLFVSDILHE
THGTDQSADFNSKLFVIDAVK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattagaattgaagatcagaatctgctgtttcatttacagacggaccataccagc
tacatttttcacatgatggaaaatggtgaactcggccagatctattatggcaaacgggtt
cactcaaagccttcatacgataatttggtaaccagagagtggcataatgccgccgctgtt
tggcgacttgaccataaggacgtgcagccgcaggtccttaaacaagaatatgccagcttg
gggaagggtgatttccgttacccagcctaccaagttgcgcaagcaaatggcagccgcatt
actgaatttaagtatgagagttacgagttggtggacggtaaacaacgcttggccgggctg
ccatcggcatttgatgatacggatgacgacgcccagactttgacgattgcattacgggac
aaattgttgggattagtgatgcatttgaactacacgatttttccccatcaagatgtcatc
gtccgcagcgcagagttccagaaccagggtaatgaaaagctcaggttgaattcggcagcc
agcgcccagcttgatttaccagatgccgactacgatttcattcagttctctggtgcctgg
gcccgcgaacgtcatatgattcgaacgcacttacgctccggtgttcaaagtgttggcagc
ctccgcggtacttccagtcatcaacaaaatccctttgtgatgctggcacgtccgaatact
gatgatgcacagggttcagtctttggttttaatctgatttattccgggaacttttccgac
caggttcaagttgatcagtatgatgccagccgggttcttgtggggattaacccagaagaa
ttcgcttggaatctcaagccgggcgacaaattccagactcccgaagctgttctcagttac
acggatgctggaatgaaccagttaagccagcaaatgggcgccttctaccaagatcacctg
gttaacccacgatttgcccacgagcagcggccaacgttgattaataattgggaagccacc
tttatggactttgatgaagacaagttgttaagcttcgcgaccaccgccaagaagctggga
ctggaaatgtttgtcttggatgacggctggtttggtcaccgaaacaatgacgacagctca
ttgggtaattggtttgtcaacgagccgaagttcccgagcgggtttgggacgtttacccaa
aagattcatgacttgggattgaagtttggcctgtggttcgaaccagaaatgatttcaatt
gatagtgagttgtataagcaacatccagattggttaatcaacgcccccggacgccacgct
tcacctgagcgtcagcagttcgtgctcgatatgacccggtccgaagttgtcgactatctc
ttcgatgccatgagcaagatcattgagatgaccaagctggattacatcaaatgggatatg
aatcgcaacattaccgagacttacagcagtcagctcagtgctgacgaccaattagaagtg
ccgcaccgatacattctcggtgtttatcagctctatgaccgcttggtcaaagcttatccg
gatgtcctgttcgaatcctgctcgtctggtggcggtcgcttcgacttggggatgatgtac
tatgctcctcaagcttggaccagcgatgacaccgatgcagttgagcggatgctgattcaa
tttggcacatcttatggttacccgcaaacgatgatgggtgcccatgtctcagccgtgcca
aatgatcaagtcggccggatcacttctttgaagacccgtgccaatgttgcttacttcggt
gattttggctatgaactggatattaccaagatgtctccggaagaacaacaacaggtcaaa
gaacagactgccttctacaaggaacatcgccaactcttccagtttgggaaattctatcga
atcgataacccatttgccaatggcggtaacgtcatgagctgggaagtcgtcagcgatgat
caaaagcacgcaatcgctgcgcgttatcaaattttgaatcgaccaaacaccggttacatc
cgcttgtaccttaaagggctcgaccctgacaccaagtacaccgttaatggtggcagcgaa
cagttctacggcgatgagttgatgaacgctggattgtttgtaagtgacattctccatgaa
acgcacggaactgatcagtcggctgactttaattcaaagctgtttgtcattgatgccgtc
aaataa

DBGET integrated database retrieval system