KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0280Help
Entry
Lbuc_0280         CDS       T01477                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
lbh  Lactobacillus buchneri NRRL B-30929
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
297052..297681
Genome map
AA seq 209 aa AA seqDB search
MTDFYFVRHGQTAANAAGLKQGTINSEITYLSETGKQQVESLRKGFDISFADRIIVSPLQ
RTKDTAAILNQSANLPVTYDKRLLEISYGDWDGEKNADLMSKYPKLFDFTLNDVLPAYAD
VAHGETFDHVIDRVAELMQETATNYPNDKIILVTHGFTIKAAVLAAIGRPKDMMVIEEPD
NTSVTRITLQTTTHSYYLRYYNRVVNSQF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttactttgttcgccatggccagacggctgccaacgccgccggattaaag
cagggcaccattaactctgaaattacctacctatcagaaaccggaaagcaacaggtggaa
agtttgcggaaaggtttcgatatttcgtttgcggatagaatcattgtcagcccactgcag
cggacaaaagacacggcggccattttaaatcagagcgcgaacttaccggtaacctatgac
aaacgactcctcgaaatttcatatggcgactgggatggtgagaagaacgctgatttgatg
agcaaatatcccaaactttttgacttcactctaaatgacgttcttcctgcctacgcagat
gtggcacatggtgaaactttcgatcacgtcatcgatcgcgtcgctgaattgatgcaggaa
actgcaactaattatcctaatgacaagattatcctggtcactcacgggtttacgatcaaa
gcggctgtgttggcagccatcggtcgtcccaaggacatgatggtgattgaggagccggat
aacaccagtgtgacccggatcactttacagaccacaacccactcgtattatctgcggtat
tacaaccgggttgtcaattctcagttttaa

DBGET integrated database retrieval system