KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0280Help
Entry
Lbuc_0280         CDS       T01477                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbuc_0280
   01230 Biosynthesis of amino acids
    Lbuc_0280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_0280
  Energy metabolism
   00680 Methane metabolism
    Lbuc_0280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbuc_0280
Enzymes [BR:lbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Lbuc_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297052..297681
Genome map
AA seq 209 aa AA seqDB search
MTDFYFVRHGQTAANAAGLKQGTINSEITYLSETGKQQVESLRKGFDISFADRIIVSPLQ
RTKDTAAILNQSANLPVTYDKRLLEISYGDWDGEKNADLMSKYPKLFDFTLNDVLPAYAD
VAHGETFDHVIDRVAELMQETATNYPNDKIILVTHGFTIKAAVLAAIGRPKDMMVIEEPD
NTSVTRITLQTTTHSYYLRYYNRVVNSQF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttactttgttcgccatggccagacggctgccaacgccgccggattaaag
cagggcaccattaactctgaaattacctacctatcagaaaccggaaagcaacaggtggaa
agtttgcggaaaggtttcgatatttcgtttgcggatagaatcattgtcagcccactgcag
cggacaaaagacacggcggccattttaaatcagagcgcgaacttaccggtaacctatgac
aaacgactcctcgaaatttcatatggcgactgggatggtgagaagaacgctgatttgatg
agcaaatatcccaaactttttgacttcactctaaatgacgttcttcctgcctacgcagat
gtggcacatggtgaaactttcgatcacgtcatcgatcgcgtcgctgaattgatgcaggaa
actgcaactaattatcctaatgacaagattatcctggtcactcacgggtttacgatcaaa
gcggctgtgttggcagccatcggtcgtcccaaggacatgatggtgattgaggagccggat
aacaccagtgtgacccggatcactttacagaccacaacccactcgtattatctgcggtat
tacaaccgggttgtcaattctcagttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system