KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0303Help
Entry
Lbuc_0303         CDS       T01477                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lbh00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lbh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320812..321294
Genome map
AA seq 160 aa AA seqDB search
MKTIYDYKETEMSGKTIDLSEFKNKVVVIVNTASKCGLAPQLEGLEELYKKYKNEGLVVL
GLPSNQFHQELGSDQEADDYCRIHYGVTFPMTRRVAVNGDGEDPLFTHLKEESGHGKIKW
NYTKFLVGKDGTLIHRYAPITKPESMEEAIYTALNQKNVL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatttatgattacaaagaaaccgaaatgagcggtaagacgattgacttgagc
gaattcaaaaataaagtcgttgtgattgtgaatactgccagcaaatgtggtctggcacct
cagttggagggcctggaagaattatataagaaatataagaatgagggcttggtcgtgtta
ggactgccttccaatcaattccaccaagagttgggaagtgatcaagaggccgatgattat
tgccggattcattatggtgtcaccttcccgatgactcgacgggttgccgttaatggggat
ggtgaggatccactgtttacccatctcaaagaagagtccggtcatggcaagattaaatgg
aactacactaaattcctggttggcaaagacggcaccctgattcatcgatatgcgccaatt
accaagccggagtccatggaagaggctatttatacggccctcaatcaaaaaaatgtcttg
taa

DBGET integrated database retrieval system