KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0391Help
Entry
Lbuc_0391         CDS       T01477                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbh00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lbh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417944..419272
Genome map
AA seq 442 aa AA seqDB search
MTATQIESTQDSKLVESQLSTTSEKLHNNLEVGTEKRQEIWGFGQTFNELGWQALQSLSE
EKRNEILDDLFKPGEGENYRICRIPVGASDYALNWYSLDETPGDYELKDFSIERDKKYLI
PYIKAAQKRNPDIVFSASPWSPPTWMKTKPVYNYGILKHDKKTQQAYANYFVKFIQAYET
EGIHISQLFPQNEPQRDQKFPSCYWTGEELRDFIKNYLGPTFEKAGLNTDIWLGTINSPL
EDTEMTKDETTDYPVITETVLSEPDAYRYIKGVTYQWAGKSVLQRTVQAFPELNYFQSES
ECGNGNNTWTYGEYVFNLFRHYISNGVNAYMYWNSVLQDGESTWGWLQNSMISVDSKTGQ
TTYNPEYYVMKHYAHYVRPGAHLLSYGGHAAGEATAYENTDGSVIVVMSNSMNHDRDISI
DVKGKTYEAHLKEHSFNTFVFS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacacaaatcgaaagtactcaagattcaaaactggttgagagtcagttgagc
accacgagtgagaagctccataataatctcgaagttggcaccgagaaacgtcaagaaatt
tggggctttggtcaaacatttaacgagttgggctggcaagcactacaaagcctatctgaa
gaaaagcgtaacgagattttggacgatttgttcaaacccggagagggtgaaaattatcga
atttgccggatccccgttggtgccagtgactatgctttgaattggtattcattagatgaa
acaccaggcgattatgagttaaaagatttctccatcgagcgtgataagaaatacttaatt
ccatatatcaaagctgcccaaaaacggaatccagacatcgtcttttccgcttcaccatgg
agcccgcctacatggatgaagacaaaacccgtgtacaattatggaatcttgaaacatgat
aagaagactcaacaagcatatgcaaattactttgtaaagttcattcaggcatatgagact
gaaggaattcacattagccaactgttcccacaaaatgagcctcaacgagatcagaaattt
ccttcatgctactggactggtgaggagttacgtgacttcatcaagaattaccttgggcca
acttttgaaaaagcagggttgaataccgacatctggttaggaactatcaactcgccgctc
gaagatactgaaatgaccaaggatgaaaccaccgactatccagtcattactgaaacggtt
ctttcagagcccgatgcttatcggtatattaaaggggttacctatcaatgggcaggcaag
tctgttcttcaacggactgtacaagcattcccggaattgaactatttccagtcagaatct
gaatgtggcaatggtaacaatacttggacttatggggaatacgtctttaacttattccgt
cactatatcagtaatggtgtgaacgcatatatgtactggaattctgtcttacaagatggt
gaaagcacttggggttggttacagaacagcatgatttcggttgattcaaagactggtcag
acgacctataaccctgaatattacgttatgaagcattacgcacattacgttcgaccaggt
gctcacttgctttcgtatggcggccacgctgctggggaagcaactgcttatgagaatacc
gatggtagtgtcattgtggtgatgtctaatagtatgaaccatgatcgagacatctcgatt
gatgttaagggcaaaacatacgaggctcacttaaaagaacattcattcaacacattcgtt
ttctcttaa

DBGET integrated database retrieval system