KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0391Help
Entry
Lbuc_0391         CDS       T01477                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Lbuc_0391
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lbuc_0391
Enzymes [BR:lbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Lbuc_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417944..419272
Genome map
AA seq 442 aa AA seqDB search
MTATQIESTQDSKLVESQLSTTSEKLHNNLEVGTEKRQEIWGFGQTFNELGWQALQSLSE
EKRNEILDDLFKPGEGENYRICRIPVGASDYALNWYSLDETPGDYELKDFSIERDKKYLI
PYIKAAQKRNPDIVFSASPWSPPTWMKTKPVYNYGILKHDKKTQQAYANYFVKFIQAYET
EGIHISQLFPQNEPQRDQKFPSCYWTGEELRDFIKNYLGPTFEKAGLNTDIWLGTINSPL
EDTEMTKDETTDYPVITETVLSEPDAYRYIKGVTYQWAGKSVLQRTVQAFPELNYFQSES
ECGNGNNTWTYGEYVFNLFRHYISNGVNAYMYWNSVLQDGESTWGWLQNSMISVDSKTGQ
TTYNPEYYVMKHYAHYVRPGAHLLSYGGHAAGEATAYENTDGSVIVVMSNSMNHDRDISI
DVKGKTYEAHLKEHSFNTFVFS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacacaaatcgaaagtactcaagattcaaaactggttgagagtcagttgagc
accacgagtgagaagctccataataatctcgaagttggcaccgagaaacgtcaagaaatt
tggggctttggtcaaacatttaacgagttgggctggcaagcactacaaagcctatctgaa
gaaaagcgtaacgagattttggacgatttgttcaaacccggagagggtgaaaattatcga
atttgccggatccccgttggtgccagtgactatgctttgaattggtattcattagatgaa
acaccaggcgattatgagttaaaagatttctccatcgagcgtgataagaaatacttaatt
ccatatatcaaagctgcccaaaaacggaatccagacatcgtcttttccgcttcaccatgg
agcccgcctacatggatgaagacaaaacccgtgtacaattatggaatcttgaaacatgat
aagaagactcaacaagcatatgcaaattactttgtaaagttcattcaggcatatgagact
gaaggaattcacattagccaactgttcccacaaaatgagcctcaacgagatcagaaattt
ccttcatgctactggactggtgaggagttacgtgacttcatcaagaattaccttgggcca
acttttgaaaaagcagggttgaataccgacatctggttaggaactatcaactcgccgctc
gaagatactgaaatgaccaaggatgaaaccaccgactatccagtcattactgaaacggtt
ctttcagagcccgatgcttatcggtatattaaaggggttacctatcaatgggcaggcaag
tctgttcttcaacggactgtacaagcattcccggaattgaactatttccagtcagaatct
gaatgtggcaatggtaacaatacttggacttatggggaatacgtctttaacttattccgt
cactatatcagtaatggtgtgaacgcatatatgtactggaattctgtcttacaagatggt
gaaagcacttggggttggttacagaacagcatgatttcggttgattcaaagactggtcag
acgacctataaccctgaatattacgttatgaagcattacgcacattacgttcgaccaggt
gctcacttgctttcgtatggcggccacgctgctggggaagcaactgcttatgagaatacc
gatggtagtgtcattgtggtgatgtctaatagtatgaaccatgatcgagacatctcgatt
gatgttaagggcaaaacatacgaggctcacttaaaagaacattcattcaacacattcgtt
ttctcttaa

DBGET integrated database retrieval system