KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0392Help
Entry
Lbuc_0392         CDS       T01477                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Lbuc_0392
   00051 Fructose and mannose metabolism
    Lbuc_0392
Enzymes [BR:lbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Lbuc_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419417..420754
Genome map
AA seq 445 aa AA seqDB search
MSYWNVDKIKYVGTGEKKSGLGFQYYNPDEVVGGKKMRDWLRFAVAYWHTFDQRLVDPFG
DGTAIRPYDKYTDPMDQALAKVDAAFEFYDKLGVDFLCFHDRDLAPEGDTLRETNRNLDK
VVDKIVENQKTSGMKVLWNTSNLFTNPRFVEGAGTSPYADIFAYSAAQLKHSLEIGKRVG
SENYVFWGGREGYESLWNTDMKREQEHAAKLFHMAKDYANEIGFDAQMLLEPKPKEPTTH
QYDFDAATTIAFMKEYGLDKDFKLNLEGNHANLAGHTYQHEIRVAREAGLLGSLDANQGD
KLIGWDIDEYPSNLYETTAAMTEVVENGSIGPRGGLNFDAKPRRSSFEPNDLFYGHIVGM
DSFAAGLRVAVAMKNDGVLDDIVKNRYSSFDSGIGADIESGKASMADLENYSLDKTQKDL
RDATHSDHLEEIKDTINHYIIQTLK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagttattggaatgtcgataaaattaagtatgttggtaccggagagaaaaagtcagga
ttaggatttcaatattataatccggatgaagtcgttggtggtaagaaaatgcgtgattgg
ttacgctttgcggtcgcttattggcacacatttgaccaacggttagtcgatccgtttggt
gatggaacggctattcgcccatatgacaagtacactgacccaatggatcaagcgttggct
aaagtggatgccgcatttgaattttatgataaattaggcgttgactttctttgtttccac
gatcgggatttagctcccgaaggcgatacgcttcgcgaaaccaatagaaacctggacaag
gttgttgacaaaatcgttgaaaaccaaaaaacttctggaatgaaagtgctttggaacaca
tccaacttatttaccaatccccgttttgttgagggtgccggtacttcaccatatgctgac
atttttgcttactcagcagcgcaattaaagcacagtttggaaattggtaagcgtgtcgga
tcggaaaactacgtattctggggcggccgtgaaggttatgaatcactttggaacactgat
atgaaacgtgaacaagaacatgctgccaaattattccatatggctaaagactacgccaac
gaaattggttttgatgcacaaatgctgcttgaaccaaagccaaaggaaccaaccactcat
caatatgattttgatgctgccactacgattgcctttatgaaagaatatggccttgataaa
gacttcaagcttaatttggaaggtaaccacgcgaacttggccggccatacctatcaacac
gaaatccgagttgctcgagaagccggtttgttgggctcattggatgccaaccaaggtgat
aagctgattggctgggatattgacgaatacccttcaaacttatacgagacgactgcggca
atgactgaagttgttgaaaatggtagtattggacctcgcggcggattgaactttgatgcc
aagccacgacgttcttcatttgaaccaaatgacttgttctatggccacattgtcggaatg
gatagctttgcagccggcttgagagttgctgttgcaatgaaaaacgacggcgtccttgat
gacatcgttaaaaaccgctatagttcatttgactcaggaattggtgcagatattgaatct
ggaaaagcaagtatggcagatcttgaaaattattcactggataaaactcaaaaagatctt
cgcgatgcaactcattcagatcatcttgaagagattaaagatacaattaaccattacatc
attcagactttaaagtaa

DBGET integrated database retrieval system