KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0519Help
Entry
Lbuc_0519         CDS       T01477                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lbuc_0519
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Lbuc_0519
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lbuc_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
561314..562825
Genome map
AA seq 503 aa AA seqDB search
MLTDRPKYVLSIDQGTTSTRAMIFDHSGRKVIEASKPVKQAIPHNGWVETDPNEIWTSVL
NVISSAFIDAGIHPEDIEGIGIVNQRETTLIWDKETGEPIYNAIGWQSKQTAALARKLKN
DGYSGMIHKKTGLIIDSYFSATKVRWILDHIDGAQERAEKGELMFGTVDTWLVWKLSGGE
YHVTDYSNASRTMLFNIHTLQWDDDILKLLNIPKAMLPEVKTSSELYGTTKNYQFYGIEV
PIAGIAGDQSAALIGQLAFEPGMIKNTYGDGAFIMMNTGSKPEISDDNLLTTIAYNFNGK
VTYALEGSIFAAGTALSWLADSLQLIDNVPESRQAAMNSEDDDEVYVVPAFNGLGAPYWE
QDVRGAVFGLTRGTTKDDFVKATLQSIAYGTKDIIQTMEKDTSMHIPELMADGGASRNSY
LMQFQADILNIPIQRAADENTTAFGAAILAGLAVGFWKDIDEIKSLQEPGRTFTPNMEDS
RRQKLYRGWQAAVQATRGYRVKI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagacagaccaaaatatgttttatcaattgatcaaggtacgacttcgactcga
gcaatgatttttgaccacagcggtcggaaagttattgaagcttcaaagcccgttaagcag
gcaatcccacataatggctgggttgaaacagaccccaatgagatttggacatccgttttg
aatgtgatttcttcggcgttcattgatgccggcattcatccagaagatattgagggaatc
ggcatcgttaaccaacgtgaaaccacccttatttgggacaaggagaccggtgaaccaatt
tataatgcaattggttggcagtctaagcaaaccgccgctttggcccgaaaattaaagaat
gacggctattctggtatgattcacaagaagaccggcttgattattgactcttatttctca
gcaaccaaggtccgctggattttggaccacattgatggtgctcaagagcgtgccgaaaaa
ggtgagttgatgtttggaacggttgatacgtggctggtttggaaactttccggtggcgag
tatcacgttaccgattactcaaacgccagtcgtaccatgctgtttaacattcacaccctg
caatgggatgatgatattttaaaattactcaacattccaaaggccatgctgccagaagtg
aagacttccagtgaactatatgggacgacgaagaattatcaattctatggtattgaagtg
ccaatcgccgggattgccggtgaccagtcggccgctttgattgggcagctggcgtttgaa
ccgggcatgattaaaaatacttatggtgatggtgccttcattatgatgaataccggctcc
aaaccagagatttcagatgataacctgctgacgacgattgcttataatttcaacgggaaa
gtcacctatgcgcttgaaggttcaatttttgctgccggaactgctttgtcctggttggca
gacagcctgcaactcattgacaacgttcctgaatcccgtcaggcggctatgaattccgaa
gacgacgatgaagtctatgttgtcccagcattcaacggtttaggagccccctactgggaa
caagatgttcgtggggcggtcttcggcttaactcgcggaacgaccaaggacgactttgtg
aaggcaaccttgcagtcgatcgcatacggtaccaaggacatcattcagaccatggaaaaa
gataccagcatgcacatccctgaactgatggctgacggtggcgcttcacggaacagttac
ctgatgcagttccaagctgatattttaaatatcccaatccaacgggcggctgatgagaac
accactgcatttggtgccgccatcttggctggactggcagtcggtttctggaaggatatt
gatgaaatcaagagcctccaagagccgggccgaactttcacaccaaacatggaagattca
cgccgacaaaagctgtatcgcggctggcaggctgctgtgcaggctactcggggatatcgg
gttaaaatttag

DBGET integrated database retrieval system