KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0608Help
Entry
Lbuc_0608         CDS       T01477                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00010  Glycolysis / Gluconeogenesis
lbh00260  Glycine, serine and threonine metabolism
lbh00680  Methane metabolism
lbh01100  Metabolic pathways
lbh01110  Biosynthesis of secondary metabolites
lbh01120  Microbial metabolism in diverse environments
lbh01130  Biosynthesis of antibiotics
lbh01200  Carbon metabolism
lbh01230  Biosynthesis of amino acids
Module
lbh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_0608
  Energy metabolism
   00680 Methane metabolism
    Lbuc_0608
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbuc_0608
Enzymes [BR:lbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lbuc_0608
Membrane trafficking [BR:lbh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Lbuc_0608
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lbuc_0608
  Exosomal proteins of melanoma cells
   Lbuc_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB72874
UniProt: F4FSA5
Position
649114..649803
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEEGVKQAINAGKLIKKAGIQFDFAFTSVLTR
AIKTLHYALEYSDQLWIPEVKSWRLNERHYGALQGHNKKKAAEKYGDEQVHIWRRSYDVL
PPLLKADDEGSAVHDRRYANLDPHIIPGGENLKVTLERVMPFWEDEIAPKLLDGKNVIIA
AHGNSLRALSKYIENISDEDIMNLEMATGEPVVYDFDDKLNVVSKTKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacttgtgttaattcgtcatggtcaaagtgaatggaacttatctaaccagttt
actggttgggttgatgttgatttgagtgaagaaggggttaagcaagccatcaatgctggt
aaattaatcaaaaaagccggcatccagtttgactttgcgtttacttccgtattgactcga
gcaatcaagactttacattatgctttggaatactcagaccaactttggattccggaagtt
aaatcatggcgtttgaacgaacgtcattacggcgctttgcaaggccacaacaagaagaag
gctgctgaaaagtatggtgacgaacaggttcatatctggcgtcgttcatacgatgtattg
cctccacttctgaaggccgacgacgaaggttcagctgttcatgaccgtcgttacgccaac
cttgatccacacattatccctggtggtgaaaacttgaaggttaccctcgaacgggttatg
ccattctgggaagatgaaatcgctcctaaattacttgacggcaagaacgtgattattgct
gctcatggtaactcattacgagcactttcaaagtacatcgaaaacatttctgacgaagac
atcatgaaccttgaaatggctactggtgagccagtggtttatgactttgatgacaaatta
aacgttgtcagcaagactaagttggactaa

DBGET integrated database retrieval system