KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0649Help
Entry
Lbuc_0649         CDS       T01477                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lbuc_0649
  Amino acid metabolism
   00340 Histidine metabolism
    Lbuc_0649
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Lbuc_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690578..691858
Genome map
AA seq 426 aa AA seqDB search
MQIIEDSLDQLLKQVAIRTNAVANREEVEKSVREIIANVIKDGDQAVKMYEQKFDNVELE
SLKVTQQEIDDAYEATDDTVIKALELAKANITSFHQMEVEDSFIDAKKKGVIRGEKIAPL
AAVGLYVPGGTAAYPSSILMNVIPAKIAGVSRIVMVTPPQKDGLNKAVLAAAKIAGVDEI
YTVGGAQAIASLAYGTETVPRVDKITGPGNVFVATAKKQVFGQVDIDMIAGPSEIGVIAG
SQAVPSQVASDLLSQAEHDKLARPILVTDDRSLAEAVSKEMDRQVDLLPRKEIAKAAMDN
EGFIAVVDDIDDAFTLMNAVAPEHLEVQLPDAIEYLNQIKNAGSVFLGFSASEPLGDYLA
GPNHILPTGGTARFFSPLGVQDFVKRTQFVSYTRDALKNEKDAITTLARVEGLEAHARAI
ESRFDD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattattgaagattccttagaccaattattgaaacaggttgccatcaggaccaac
gcggttgctaaccgtgaagaagttgaaaaatcagtgcgggaaattatcgccaatgtcatc
aaagatggtgatcaggcagtgaaaatgtacgaacagaaatttgataatgtcgagctggag
agtttgaaagtcacccaacaggaaattgacgatgcctatgaagcgactgatgacacagtg
attaaagccttggaacttgccaaagctaatattacgtcatttcaccaaatggaagtggaa
gacagttttattgatgcgaaaaagaaaggcgttattcgcggtgaaaaaatcgccccactg
gcagcagttgggctctacgttccaggtgggacggcagcttatccgtcttccattttgatg
aacgtcattccagccaagattgccggggtttcaagaattgtcatggttacgccaccacaa
aaggacgggttaaataaggcggtcttggcggctgctaaaattgccggggttgatgaaatt
tatacggttggcggtgcccaagccattgctagtttggcatacggaactgaaacggtgcca
cgggtggataagattaccggacccggtaacgtgtttgtcgcaacggcgaaaaagcaggtg
tttggtcaggtcgacatcgacatgattgccggtccctcagaaattggtgtgatcgccggg
tcccaggcggttcccagccaggttgcttcggatttattgtctcaagcagaacatgacaaa
ttggcccgaccaattttagtcaccgatgaccgttcactggccgaagctgtcagcaaggag
atggatcgccaagttgatttactgcccagaaaggaaattgccaaagcagcgatggataat
gaaggcttcattgccgtcgtagacgatattgacgatgcctttaccctgatgaatgccgtt
gccccggaacatttggaagtccaattacccgatgccattgaatacttgaaccaaatcaaa
aacgccggctccgtcttccttggattttcagcttccgagcccctgggcgactacctcgca
ggccctaatcacatcttaccaaccgggggcacggcacggttcttctcgccgctcggagtt
caagattttgttaaacggacacaatttgtttcctatactagggatgccctgaaaaatgaa
aaggatgccatcacgactctggcacgggttgaaggtctcgaagcccacgccagggcaatt
gaaagccgctttgacgattaa

DBGET integrated database retrieval system