KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0722Help
Entry
Lbuc_0722         CDS       T01477                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lbuc_0722
Enzymes [BR:lbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lbuc_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767684..770167
Genome map
AA seq 827 aa AA seqDB search
MDHSIDLFGSEQNNHEPQYVDGRLKAIFFSSNDSFYKVVLVEITETNVNWPEDEIVVTGN
FGDLVEENSYHFTGKLVDHPRYGKQFQASNYTSVIATTREGVVKYLSGDQFPGVGKKTAE
RVVDVLGDDAIEKITADNRVLDDVPISAKLRSAIIENLDADDNLEKTIVGLNSYGFSSAI
ASAIYQKYHEDALKIISDNPYQLVEDIDGISFKKADAIALRLGIVPDSNERIRAGLMYAI
DELCLQNGDTYTTTAPLIQTATSLLEGNSQQQIPGKKLAESLVELAKEGKVVGEEDRIYL
TRLYNAEVQIADHLNRVIKNQDDEDHLKEDAIKKQLRVVEKQFDINYDDSQVAAIVQAIQ
SPAFILTGGPGTGKTTIINGIVNTFARLHEYSLDINSYKDKPFPIVLAAPTGRAAKHMTE
STGLPASTIHRLLGLNGRESNDTTGTKDIEGALLIIDEMSMVDTYLFRSLVRAIPNHMQV
VLVGDQDQLPSVGPGQVFHDLLVSKQIPAMQLNTIYRQEKGSSIIQLAHDIHRGQLSENF
TQNQSDRSFIPCNEYQISSVIEQVTKRAKQKDFGLMDVQVLAPMYRGRAGIDRLNDVVQE
VWQGDPTGKKSVAIREHTYRIGDKVLQLVNNPENNVFNGDIGIIVGMDAPKGQQVPNKIT
IDFDETEVTYEKNEWTQFTLAYCTSIHKAQGSEFKMVILPIVRQFSRMLQRNLLYTAVTR
ASDFLIMLGEKEAFEQCVRNVSVNRQTSLVKRLVDTIGIQPQSKSADGEPEAEDQKQLPT
GTPSAQETDDAKADNLPDHLTTAVINQNLIDPMIGMGDVTPRDFLKS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
ttggaccattcaatagatttatttggctcagaacagaataatcacgaaccacaatatgtc
gatggccgattaaaggcgatcttcttttcgagtaatgacagtttttataaagtcgtctta
gttgaaattacggagaccaatgtcaattggccggaagacgaaatcgtcgtcaccgggaac
tttggcgatttggttgaagaaaacagctatcatttcaccggcaaattagtcgatcatccc
cgttatggcaagcaatttcaagccagcaactacaccagtgtgatcgccactaccagagaa
ggggtcgtcaaatatttatcaggcgatcagttccccggcgttggtaagaagactgccgaa
cgggtggtggatgttcttggcgatgatgcgattgaaaagattaccgcggataaccgtgtc
ttggatgacgttcccatcagcgccaaattgcgatcggcaattattgaaaatcttgacgcc
gatgataacttggaaaagaccattgttggactgaacagctatggtttttcgagtgcgatt
gcttcggcgatttaccaaaaatatcatgaagatgctttgaaaatcatttctgataatccc
taccaattagtcgaagacattgacggcatcagcttcaaaaaagccgacgccattgccctt
cgattggggattgtgccggattccaacgaacggattcgtgccggattgatgtatgcgatt
gatgaattatgccttcaaaatggggacacatataccacaaccgccccattgattcaaact
gccacgagccttctggaggggaattcccagcagcagattcctgggaaaaagttggccgag
agtttggttgaactggctaaagaaggcaaggttgtcggcgaagaagaccgcatttattta
acccggctatacaacgccgaagtccaaattgccgatcatttgaaccgggtgatcaaaaat
caggatgatgaagatcatctcaaagaagatgcgatcaaaaagcaattgcgagtcgttgag
aagcagtttgatattaattatgatgattcccaagttgccgcgattgtccaagccatccag
tcaccggcatttattttgaccggtggcccgggaaccgggaaaaccaccattatcaacggc
attgtcaacacatttgcccgactacatgagtattcactggatattaattcctataaagac
aaaccgtttccaatcgtgttggccgcaccaaccggtcgagccgccaagcacatgactgaa
tctaccgggttgccagccagcaccattcatcgactgcttggtttgaacggccgtgagtcc
aacgacaccactggtacgaaggatattgaaggggcactattaatcattgatgagatgtcg
atggttgatacttacttgttcaggtcgttagttcgggcaattcccaaccatatgcaggtg
gttttggttggtgaccaggatcaattaccatcagtgggaccaggccaggtattccacgat
ttgctggtttctaagcagattccggccatgcagctgaatacaatttaccgccaggagaag
ggctcatcgattatccaattggctcacgatattcatcgggggcagctgtcggaaaatttc
actcagaaccaatccgaccgctcgtttatcccatgtaacgagtaccagatctcttcggtc
attgaacaggtcactaaacgtgccaagcaaaaagacttcggcttgatggacgtccaggtt
ctggcaccgatgtatcgcggtcgagccggaattgacaggctaaatgacgtggttcaagaa
gtctggcagggtgatccaactggtaaaaagtcggttgcgatcagagaacacacttatcga
attggcgacaaagtgctccagctggttaataaccctgaaaataacgtcttcaatggcgac
attgggatcattgtggggatggacgcccctaaaggacagcaagttcccaataagattacg
attgattttgatgagaccgaagtgacttatgagaagaatgagtggacccaattcaccttg
gcttactgcacgtcgattcataaagctcagggtagtgaattcaagatggtgattttacca
atcgttcggcagttctcccggatgcttcagcgcaacttactgtatacggccgtgacccga
gccagcgactttttgattatgctgggtgaaaaagaggcctttgaacaatgtgtccgcaac
gtatcggttaaccggcagaccagtttggtcaaacggctggtagatacaattggcattcag
ccgcaatcaaaaagcgctgacggagagccggaagctgaggatcaaaagcaattgccgact
ggcacgccatcagcccaagagactgatgatgctaaggccgataatctgcccgatcattta
accacagcggttatcaatcaaaatctgattgacccgatgattggcatgggggatgtcact
ccccgcgatttcttgaagtcatag

DBGET integrated database retrieval system