KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0726Help
Entry
Lbuc_0726         CDS       T01477                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lbuc_0726
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Lbuc_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773441..774358
Genome map
AA seq 305 aa AA seqDB search
MTNKVVVLGSLNVDTTLHIDQMPKPGETISAKSKTNSAGGKGANQAVAAARSGAQTSFIG
QVGDDSNGIFMIDALKLDGINTDHVGINQVDGTGSAVILLDSQGQNSIMVYGGANQAMKT
EVIADSQALIKSADILISEFETPQEVTYEAFKLAKQHGVTTILNPAPASKIIYGLLEVTD
LIVPNETESATLTGIEVNDTDSMDQNAAKFSEMGIDNLIITVGDRGAYYHTPSNSGFVPA
FKVKAKDTTAAGDTFIGAFSSQINQDLSNIEAALVYAQKASSITVQRLGALPSIPTAEEI
KAEYK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagtggttgtgctcggaagtctaaacgttgatacaacattgcacattgac
caaatgccaaaaccgggggaaacgattagtgccaagagtaaaaccaattccgctggcggt
aaaggggccaatcaagcagtcgcagctgcccgttccggtgctcagacgagttttattggg
caagtgggtgatgatagcaacggcatctttatgatcgatgctttgaaacttgacggcatt
aataccgatcatgtgggtatcaatcaggtcgatgggaccgggtctgcggtcattcttctg
gacagccagggtcaaaacagcatcatggtttatggtggggctaaccaagccatgaaaacc
gaagtcatcgccgacagccaagccctgattaaaagtgccgatattttaatttccgaattt
gaaacgccccaggaagtcacctacgaagcgtttaagttggccaaacaacatggtgtgacc
acgattttaaatccggcaccggcttcaaaaatcatttacgggttgctcgaagtcaccgat
ttgattgttcccaacgaaaccgaaagtgccacattgaccggtatcgaagtcaacgatact
gattcaatggatcaaaatgccgctaaattcagcgagatgggtatcgataacttgatcatt
acggtgggcgatcgcggcgcgtactatcatactccaagcaacagtggctttgtgccggca
ttcaaagttaaggcaaaagacaccacggcagctggcgacacatttatcggggctttcagt
tcacaaattaaccaagatttatccaatattgaagcagctttggtttatgctcaaaaggct
tcatccattacagttcaacgtttaggggccttaccttccattcccacggccgaagaaatc
aaagcggaatacaaataa

DBGET integrated database retrieval system