KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0738Help
Entry
Lbuc_0738         CDS       T01477                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00010  Glycolysis / Gluconeogenesis
lbh00020  Citrate cycle (TCA cycle)
lbh00620  Pyruvate metabolism
lbh01100  Metabolic pathways
lbh01110  Biosynthesis of secondary metabolites
lbh01120  Microbial metabolism in diverse environments
lbh01130  Biosynthesis of antibiotics
lbh01200  Carbon metabolism
Module
lbh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_0738
   00020 Citrate cycle (TCA cycle)
    Lbuc_0738
   00620 Pyruvate metabolism
    Lbuc_0738
Enzymes [BR:lbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lbuc_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEB73002
UniProt: F4FT83
Position
785164..786504
Genome map
AA seq 446 aa AA seqDB search
MAYKFKLPEMGEGITEGEIATWDVKVGDTVKEDDPLVEIQNDKSVQEMPSPVAGTIKSIE
KQEGETAEKGDVLVVIDDGSPDEPDDAAPAAAPAKEEAAPAPAKEEAPAPAAAPAPAAAP
AAVTAAPAASNPNAIVKAMPSVRQYARDTGVDITAVPATGNHGQITKADIDNFNPAAAPA
APAAAATAAAPAGEAKAAAGQAIKPWKSDQPDLETREPMSPMRKIIAKSMRTSKDIAPHV
TSFDDVEVSALMANRKKYKQAAADQDIHLTFLPYIVKALVAVMKKYPEFNASIDDTTQEI
VYKHYFNVGIATNTDHGLYVPNIKNADSKGMFEIAKEITENTQAAYDNKLGPDTMKGGSI
TISNVGSIGGGWFTPVINQPEVAILGVGKIAKEPYVDPEDGEIKVGNMLKLSLSYDHRLI
DGALAQNALNYMNQLLHDPAMLLMEG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcttataagtttaaactaccagagatgggagaaggaattactgaaggtgaaatcgct
acctgggatgtaaaagttggcgataccgtcaaggaagacgatccgttagttgaaattcaa
aacgataagtctgtccaagaaatgccatctccagttgccggaaccattaagagtattgaa
aagcaggaaggagaaaccgcagaaaagggcgacgttttagttgtcattgatgatggttct
cctgatgaacctgatgatgccgcaccagcagctgcacctgcaaaagaagaagctgctcca
gctcctgctaaagaagaagcacctgcaccggctgccgcaccagcacctgccgctgctcca
gccgcagtaactgctgcaccagctgcttcaaatccaaacgcaattgtcaaagcgatgcca
tctgttcgtcaatatgcacgtgacacaggcgttgacattactgctgttcctgccacagga
aatcatggtcagatcaccaaagctgacattgacaacttcaatccagctgccgctccagcc
gcaccagctgccgctgcaaccgctgctgcaccagctggcgaagcaaaagctgccgcaggt
caagctatcaaaccttggaagtctgatcaacctgatcttgaaacccgtgaaccaatgtct
ccaatgcgtaagatcattgctaagtcaatgcgtacatctaaggacattgcgcctcacgta
acttcatttgacgacgttgaagttagtgcattaatggctaaccgtaagaagtacaagcaa
gcagctgccgaccaagatattcatttgacattcttaccttacattgtgaaggcattggtt
gccgttatgaagaaatatcctgagttcaacgcttcaatcgatgacaccactcaagaaatc
gtttacaagcattacttcaatgtcggtattgcaaccaacacggaccacggtctgtacgta
ccaaacatcaaaaatgctgattccaagggtatgtttgagattgctaaagaaattaccgag
aacacccaagctgcctatgacaataagcttggcccagatacaatgaagggtggttcaatt
accatcagtaatgttggttcaattggcggtggctggttcacaccagttatcaaccaacct
gaagttgctatcttaggtgttggtaagattgccaaggaaccatatgttgatccagaagac
ggcgagattaaagtaggcaatatgctgaaactttcattgagctacgatcacagattaatt
gatggtgcccttgcacaaaatgctttgaattacatgaatcaattgcttcatgatccagca
atgctgttgatggaaggatga

DBGET integrated database retrieval system