KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0853Help
Entry
Lbuc_0853         CDS       T01477                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Lbuc_0853
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lbuc_0853
Enzymes [BR:lbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Lbuc_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(911604..912950)
Genome map
AA seq 448 aa AA seqDB search
MSLKSSIATAAGKSSYWFLHTFFKGGSSLPGKITKRLDPEILATLGRDYDVIVITGTNGK
TLTTALTVQVLKEKYDNILTNPTGSNMEQGIITTFLHAPKSKGKRPLAVLEVDEANVIMV
TKYIKPKAFVFTNIFRDQMDRYGEIYTTYNKILNGVALAPNATIIANGDAPIFHSKQLPN
PIVYYGFDNQKDGDIKATPNTDGVLCPQCQHVLHYHFISYSNLGKYFCPNCGFERPELNF
ALNKINDLTPKSSTFEIDGEPIKIGIGGVYNIYNALAAYSVGRFMGVSPAQTKKAFEKGK
RIFGRQEEINVDGKLVTLILVKNPVGLNQVIDMISTDKDPFTFIGLLNANYADGIDTSWI
WDGDFERLPKMNIKQFITGGERYKDITYRLQVAGVDPKKHLVEPDLDKVVEMIPKAPTKK
VYILATYTAMLHLRKVFAAKGFIKGGMD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaaaagttcaattgcgactgcggccggtaagtcgtcttactggtttctgcat
acatttttcaagggcggcagttcgcttcccggtaaaatcaccaaacggctcgatccagaa
attttggcaaccctgggccgtgactacgacgtgatcgtcatcaccggtaccaacggtaaa
acgctgacgaccgctctgacggttcaagtactcaaagaaaagtatgataacattttgacc
aaccccaccggctcgaacatggagcaagggatcattaccactttccttcatgcaccaaag
tcaaagggcaagcggccattggctgtactggaagtcgatgaagccaatgtcatcatggtt
accaaatacatcaaaccaaaagcatttgttttcaccaacattttccgagatcaaatggat
cgttatggcgaaatctatacgacctataataaaattttgaatggggtcgccttagctccc
aacgccaccattatcgccaatggtgacgcgccgatttttcattcaaaacaactgccgaac
ccgatcgtctactacggcttcgacaatcaaaaagatggcgacattaaggcgacgcccaac
acggacggcgttctctgtccccaatgtcagcatgtcctgcactaccatttcatcagctat
tccaatctgggcaagtacttctgccccaactgtggttttgagcggcccgaattgaatttt
gcgctgaacaaaattaacgacttgaccccgaaatcatctacctttgaaatcgatggtgag
ccgattaaaattgggatcggtggggtttacaacatctacaatgccctggcagcttattca
gttggccgattcatgggagtctcccctgctcagaccaagaaagcctttgaaaaaggaaaa
cggatctttggccgccaagaagagatcaacgttgacggcaagctggtgacgctgattctg
gttaaaaaccccgtcggcctcaatcaggtgatcgacatgatttccactgacaaggacccg
tttaccttcatcgggctcctcaatgccaattacgcagatggcattgataccagctggatt
tgggatggcgattttgaacgactgcccaagatgaacatcaaacagttcattactggcggt
gagcggtacaaagatatcacctaccgcctccaagttgccggagtcgacccaaagaaacac
ttggttgaaccggatttggacaaagttgtcgaaatgatccccaaggcaccaaccaaaaag
gtttatatcctcgcaacttacaccgctatgctacacttaagaaaagtatttgcagccaaa
ggctttatcaagggaggaatggattaa

DBGET integrated database retrieval system