KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0869Help
Entry
Lbuc_0869         CDS       T01477                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lbuc_0869
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lbuc_0869
Enzymes [BR:lbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Lbuc_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926090..927400
Genome map
AA seq 436 aa AA seqDB search
MEKIIVHGGKPLRGKVHIDGAKNAVLPIQAATILAGEGKTVISNVPLLSDVYTMNKVLRF
LNVKVDFDEANNEITFDASKDISSEAPFEYVSKMRASIVVMGPLLARLGHAKVALPGGCA
IGSRPIDLHLKGFEALGARIEQHDGYVEAYAPDGLTGAEIYLDFPSVGATQNIMMAATLA
KGKTVIQNAAREPEIVDLANVLNKMGAKVVGAGTEQIRVEGVPELHGTDHAVVQDRIEAG
TFMIAAAVTRGNVMIDGAIPEHNKPLILKMREMGVTINESDDGIQVIGHDNLKPVDVKTM
PHPGFPTDMQPQMTILQLTANGSSSMTETVFENRFMHMEELRRMNAQYTISGRTVIMDGP
TDFNGAEVAATDLRAAASLVIAGLAASGYTTVTNLQYLDRGYHDFHKKLANLGAEIKRVN
VEDDSIVLNQSLKNRS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaattattgtacatggtggtaagccacttcgagggaaagtacatattgatggg
gccaagaatgccgttttaccaatccaagctgcaactattttagccggtgagggaaagacg
gttatctcaaatgtgccattgttgtctgatgtgtataccatgaataaagtgttgcggttc
ttaaatgtgaaggttgattttgatgaagccaataacgaaattacgtttgatgcttcaaaa
gatatctccagtgaagcaccttttgagtatgtctcaaagatgcgtgcctcaattgttgtc
atggggccgcttttggctcgactcgggcacgcaaaggttgctttacccggtgggtgcgca
attgggtcacgaccgattgatctgcatttaaaaggatttgaagctttaggtgctcggatc
gaacagcatgacggctacgttgaagcttacgccccggatggccttaccggcgctgaaatc
tatctggattttccaagcgttggtgccactcaaaacattatgatggctgcaacattagct
aagggcaaaacagtcattcagaatgctgcccgcgagccggaaattgttgatttggccaac
gttttaaacaagatgggggccaaagttgtcggcgccggaaccgaacagattcgcgtggaa
ggggttcctgaacttcatgggaccgatcacgcggtggttcaagatcgaattgaagccgga
acattcatgatcgctgctgcggttacccgtggtaacgtgatgattgatggtgctattccc
gagcataacaaaccactgattctcaaaatgcgcgagatgggcgttaccatcaacgaaagc
gatgatggcattcaagtcatcggccacgataatctcaaaccggttgacgttaagacaatg
ccgcatcccggctttccaaccgacatgcagccgcaaatgaccattttacagttgacggcc
aatggcagcagctcaatgactgaaaccgttttcgaaaatcgtttcatgcacatggaagag
ctgcgccggatgaatgctcaatatacgatctccggtcgaacagtcatcatggatggccca
actgattttaatggcgccgaagttgcggccaccgatctgcgggccgccgcatccttggtg
attgccggcttggccgctagtggctataccaccgttaccaacttacagtacctggatcgt
ggttaccacgatttccacaagaagctcgctaatttaggtgctgaaattaaaagagtcaac
gttgaagacgactcaatcgtcttgaatcaatcgctcaagaatcgttcataa

DBGET integrated database retrieval system