KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0917Help
Entry
Lbuc_0917         CDS       T01477                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lbuc_0917
Enzymes [BR:lbh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Lbuc_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977273..977872
Genome map
AA seq 199 aa AA seqDB search
MFEFLEGTVVDITPTHIVLLVGGVGYLINTADPYRFNVDEKKVIRVYIYQSVSDTAILLF
GFATIEDKQIFEKLISVSGIGPKSALAILAGNDRDGLITAINNEDVKFLTKFPGVGKKTA
RQIILDMQGKLDDIATNGVSLAQPLGSNEKSPELADALSALEALGYGAKQIAAIEPDLVK
QADLSTDEYLSLGLKLLMH
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttttggaagggacggttgttgatatcacacccacccacatcgttttatta
gtgggcggcgttggttatttgatcaataccgcagacccgtaccgttttaatgttgatgag
aaaaaagtcatcagagtctatatttatcagtcagtgagcgatacggctatcttgctgttt
ggctttgcgaccattgaagacaagcagatctttgaaaagttgatttcggtttccgggatt
ggccccaaaagcgctttggcaattttggccggcaacgaccgggatggattgatcaccgca
attaataatgaagacgtcaagtttttgacgaagttccccggagttggtaagaaaactgcc
cgccagattattttggatatgcaggggaagctcgacgacattgcaactaatggtgtttcg
ctggcccaaccgcttggcagtaacgaaaagtctcctgaattggccgatgcgttatcggca
ttggaggcgctgggttatggtgccaaacagattgccgccatcgagccggatttagttaag
caagctgatttgtcaaccgatgaatacttaagtttaggattgaaactgttaatgcattag

DBGET integrated database retrieval system