KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1050Help
Entry
Lbuc_1050         CDS       T01477                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lbuc_1050
   00670 One carbon pool by folate
    Lbuc_1050
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Lbuc_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112327..1112812
Genome map
AA seq 161 aa AA seqDB search
MLAFIWAEDANGLIGANGQLPWHLPDDMHYFKETTMGNTIISGSKTFRSYNRPLPGRENI
VVSHQTDFPTGIKVIPSIEQLCDLIAQNPDKQYIVTGGANLFAQLRSKVDRLYRTKIEAE
FSGDTYMPAIDYSLFELSKSVVGVVDAKNKYPHTFEVFDRK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttagcttttatctgggctgaagacgccaacggtttaattggtgccaatggtcaactt
ccttggcatctgccggacgatatgcattacttcaaagaaaccacgatgggcaatacgatt
atttccggatcgaaaaccttccgcagttataatcggccactgccgggtcgtgagaatatt
gtggtttcacaccaaactgattttccaacgggcatcaaagttatcccttcgattgaacaa
ctgtgtgacttgattgctcaaaatcccgataaacaatatattgtgaccggtggtgccaat
ctatttgcccaattacgttcaaaagtcgaccggctttatcgcacgaagattgaagctgaa
ttttccggtgacacctatatgccagccattgactattctttatttgaattgagcaaatcg
gtcgttggtgttgttgacgccaaaaataagtatccccacacttttgaagttttcgataga
aaataa

DBGET integrated database retrieval system