KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1062Help
Entry
Lbuc_1062         CDS       T01477                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1124473..1125996
Genome map
AA seq 507 aa AA seqDB search
MNDQQYIMSIDEGTTSTRAILFNNDGDIVGKAQREFHQYFPKSGWVEHDANEIWNAVQSV
ISEALINADVQPYKVRGIGVTNQRETTVIWDKNTGEPIYHAIVWQSKQTAALADQLKHDG
YDHDGYDDMIHEKTGLIIDSYFSATKIQWILDHVDGARQKAENGDLLFGTIDTWVLWKLT
GGKVHATDYTNASRTMLFNIHTLTWDKDILDLLHIPESMLPEVRSSSEIYGYTAGYSFSG
VQVPIAGIAGDQQAALFGQMALQRGMIKNTYGTGAFIVMNTGEEPTLSKRGLLTTIAYGI
NGKVNYALEGSIFVAGSAIQWLRDGMEMVKSSPDSEQMAIDAKSTDGVYVVPAFTGLGAP
YWDQDARGAVFGLTRGTTKNQFVRATLESLAYQTRDVVDTMAAETGIDLKSLAVDGGAAN
NNYLMQFQADILGTPIQRASISETTALGAAYLAGLAVGFWDSIEEIRLTVKSRDAFEPQM
DEQTRTKLYTGWQKAVQATIQYHPDED
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcagcaatacataatgtccattgatgaggggacaacaagtacccgggcaata
ttgtttaataatgatggtgatatcgttggtaaagcacaacgggagttccaccagtatttt
ccaaaatctggttgggttgaacacgatgccaatgagatttggaatgccgttcaatcagtg
atctcagaagccttgattaatgcggatgtccaaccatacaaggttcggggaattggtgtg
accaaccagcgggaaaccacggtcatttgggataaaaataccggcgagccgatttatcat
gccattgtttggcagtccaaacaaaccgctgcgttagccgatcagctcaagcacgatggt
tatgatcacgatggttatgatgatatgatccatgaaaaaaccggcttgatcattgattcc
tacttttccgcaactaagattcaatggattttggatcatgtagacggcgctcgccaaaag
gccgaaaatggcgatttattgtttggaaccattgatacctgggtcctttggaagttgacc
ggcggcaaggttcatgcgactgattataccaatgccagtcggacgatgctgtttaacatt
cacacgttgacttgggacaaagatattttggacctgctgcacattcctgaaagcatgctg
ccggaagtccgctcatcgtcagaaatttatggttatacagctggttattccttctcgggt
gttcaggttccgattgctggaattgccggtgaccaacaagcagctttgtttggccaaatg
gcgctgcagcgcgggatgatcaaaaacacttatggaaccggtgcctttatcgtcatgaat
accggtgaggagccgacactttccaagcggggactgttgacgaccattgcatatggaatc
aacggcaaagtcaattatgccttggaaggaagtattttcgtcgccggttctgccattcaa
tggcttcgagacggaatggaaatggttaagtcatcccctgactcggaacaaatggcgatt
gatgctaaaagtaccgatggcgtctacgtcgtcccagcctttaccgggttgggtgcgccc
tactgggatcaggatgccagaggggcggtctttggcctgactcgtggcacgaccaaaaat
cagtttgttcgagctacgcttgagtcattagcttatcaaaccagggatgttgttgacacc
atggcagctgaaaccggaatcgatttgaagtcgctggcagttgacggtggggcagctaat
aacaattatctcatgcaattccaagctgatattttgggaacgccaattcagcgggcctca
atttcagaaaccaccgcgctgggtgcagcctacctagcaggcttggcagtcggcttttgg
gattctatcgaagaaattcgcctgaccgttaaatcacgcgatgcttttgaaccgcaaatg
gacgagcagacacgcacaaaactgtataccggttggcagaaggccgtccaggcaacgatt
cagtatcatcccgacgaagactaa

DBGET integrated database retrieval system