KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1240Help
Entry
Lbuc_1240         CDS       T01477                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.7)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lbh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lbh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303959..1305494)
Genome map
AA seq 511 aa AA seqDB search
MAQITVAEVLVLLKEHNLLLESQLSSSSHPFDQISYNSKSVTDNCLFFCKGNFKSAYLDD
ARQNGATAYMSEKTYQNAGIPGIIVKNIQKAMSLVSAAFFGFPQDQLPTIAYTGTKGKTT
SAYFTKAILDQTYQRKVALSSTINTVVGLKPEDVVKSNLTTPESLDLFTMMRKAADNGMS
HLVMEVSSQAYKKNRVYGLHYDVGVFLNISPDHIGRNEHPTFADYLHCKEQLLVNSDVCV
LNADGTHLTDIFYAAKATTQPENIFIYGRAGQNQETEFPVDVEYRSLKDSLTENQIQVTA
RTAKAKQLNIDGVYRIGIPGDYNEGNAVAAAITSALMGAKPTEIAYGLANTTVPGRMEIY
QTHDHGTVYVDYAHNYGSLHSVLDFLKKQAPNGKVTVITGSTGDKGIDRREGLGKAINEA
ADQAYLTTDDPATEDPQQIAKEIAAHIDTSKVATTYIPDRKQAITKAVSESQKGDLVVVA
GKGHDQYQKINGKNVPYEGDAAIVKNLVKGL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaaattactgttgctgaggttttagttttactcaaagaacataatttattgctt
gaaagtcaattgagcagctcaagtcatccctttgaccagatttcatataactctaaatcg
gtcactgacaactgtttgttcttctgtaaggggaacttcaaatctgcgtatctggatgat
gccagacagaatggcgccaccgcgtacatgtccgaaaagacataccaaaatgccggcatt
ccaggcattattgttaagaatatccaaaaagcaatgtcgctcgtaagtgcggcatttttt
gggtttccacaagatcaattgccaacgattgcctacactgggacaaaggggaaaacgaca
tctgcttactttaccaaagcaattctggatcaaacttatcagcgaaaggttgctttatcc
tcaaccatcaatacggttgtcggattaaagcccgaagatgttgttaaatcaaatttaacg
actcctgaatcgttggatttgtttaccatgatgcgaaaagccgctgataatggcatgagt
catttagtgatggaagtttcatctcaagcctacaagaagaatcgggtttatggtctgcat
tacgatgttggggtttttctcaacatttcacctgaccatattggtcgcaacgagcaccca
acttttgccgactatttgcactgcaaagaacagttgttggttaattccgacgtttgtgtg
cttaacgctgacgggacacatttaaccgacatcttttacgcggctaaagcaaccacccaa
cctgaaaatatctttatttatggacgggctgggcagaatcaggaaactgaatttccagta
gatgtcgagtatcgatcgttaaaggattcgctgacggaaaatcaaatccaagtgactgcc
cgaaccgccaaggcgaagcaattgaacattgacggtgtataccggattggaattcctgga
gattataacgaaggcaatgcagttgccgctgcgattaccagcgccttgatgggggccaaa
ccgaccgagatcgcttatggtctggccaataccacggttcccgggcgaatggaaatttat
cagacccatgatcacggaacggtttacgttgactatgcccacaactatggcagtttacat
tccgttctcgatttcttgaaaaaacaggctcctaacggtaaagtgacggttatcaccggc
agcacgggtgataagggaattgatcgtcgcgagggccttggcaaagcaatcaacgaggct
gccgatcaggcttatttaacgaccgatgacccggcaaccgaggatccgcaacaaatcgcc
aaagaaattgctgctcatatcgatacctcaaaagtggctacaacctacatccccgaccgc
aagcaagccattaccaaggccgtttccgaaagtcagaagggtgacttggtagtggttgcc
ggtaaaggtcatgatcaatatcaaaagattaatggcaaaaacgttccgtatgaaggcgat
gcggcaattgttaaaaatcttgtgaaaggactctag

DBGET integrated database retrieval system