KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1318Help
Entry
Lbuc_1318         CDS       T01477                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbuc_1318
   01230 Biosynthesis of amino acids
    Lbuc_1318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_1318
   00051 Fructose and mannose metabolism
    Lbuc_1318
   00562 Inositol phosphate metabolism
    Lbuc_1318
Enzymes [BR:lbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lbuc_1318
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lbuc_1318
  Exosomal proteins of bladder cancer cells
   Lbuc_1318
  Exosomal proteins of melanoma cells
   Lbuc_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1384757..1385515)
Genome map
AA seq 252 aa AA seqDB search
MRIPFVAGNWKMNLSVAEAVKFLQAIEGKLPDPKITETCIAASPLFLESMVEENGDSPLI
ISAENCFYEDEGAYTGETSPKALAEMGVTHVIIGHSERRKYFNETDDIINKKVHAAFRNQ
LTPIICCDETMSRRESADRISWVVSQVTNALKSITPQQAEKIIVAYEPSWAIGSGKTASS
DEAEEGCYLIRQTIADLYGDDIADQVRVLYGGSVNDENADDILSQTDIDGVLAGGASLKP
DSFLKLANFLQK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaattccgttcgttgcgggtaactggaaaatgaatttatcagtcgctgaagcagtc
aaatttcttcaagccatcgagggtaaattacccgatcctaagataactgagacctgtatt
gcggcttcgccactctttttggagagcatggtcgaagaaaatggtgattcaccactgatt
atctccgctgaaaattgtttttatgaagacgagggcgcatacaccggggagaccagcccc
aaagcgcttgccgaaatgggcgtgacccacgttattattggtcattcagagcgtcgtaag
tactttaacgaaaccgacgacattattaataaaaaggttcacgctgcttttcgcaaccaa
ttaacaccaatcatctgctgtgatgaaacgatgagccggcgtgaatccgctgatcgaatt
tcctgggtggtcagtcaagtgaccaacgcccttaaatcgattaccccgcaacaagctgag
aagatcattgttgcttacgaacccagttgggcaatcggcagcggcaaaaccgccagcagc
gatgaagccgaagagggttgttatttaattcgtcaaaccattgctgatttgtatggcgat
gatattgccgatcaagtccgagttttgtatggcggcagtgtaaacgacgaaaacgccgat
gacattctgtcacagactgatatcgacggtgttttggccggtggtgccagcttaaaaccg
gattcattcttaaagcttgcaaactttttacaaaaatag

DBGET integrated database retrieval system