KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1324Help
Entry
Lbuc_1324         CDS       T01477                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lbuc_1324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_1324
  Lipid metabolism
   00071 Fatty acid degradation
    Lbuc_1324
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lbuc_1324
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lbuc_1324
   00626 Naphthalene degradation
    Lbuc_1324
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lbuc_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391094..1392170
Genome map
AA seq 358 aa AA seqDB search
MDVNQTKEQVKQTADESIPTEMKAWEIVKPGSINGAVSPLRYTTKPVPKPKRGEVLVKVI
ACGVCHTDLHVTEGDLPVHKEHLTPGHEIVGRVVQMGAETRRFKLGDRIGIPWLRWTCGV
CEYCRSGRENLCPNSLYTGWDHDGGYAEYVTVPEGFAYRIPARFDSLTAAPLLCAGIIGY
RAYERANVPAGGTLGLYGFGGSAHLTAQIAMKQGIEVHVLTRGEDARKFALQLGAASARG
TYDMPPVKLDSAINYTPVGDVVPKAMEALKPGGTLAMAGIHSTDIPQMSYPSHIFHEKNL
TSVESNTRRDGEEFLTLADRLNIHPEVTEYPLAKADEALKYIAKGDIRGACVLRVSEG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatgttaatcaaacaaaagaacaagttaaacaaactgctgatgaatcaatccccact
gagatgaaggcctgggaaattgttaagcctggttcaattaacggtgcggtttctccttta
cgttacaccaccaagccggtgccaaaaccaaaacgaggcgaagttttggtcaaggtcatc
gcttgcggggtctgccacacggatctccatgtaactgaaggcgatctgccggttcataag
gaacatttgacgcccggtcatgaaatcgttggtcgggtcgttcagatgggtgctgaaacc
cgtcgatttaaattaggcgatcggattgggattccttggttacgttggacttgcggggtt
tgtgaatattgccggtccgggagagaaaatctctgccccaactcactttataccggctgg
gatcatgatggcggctatgcagaatacgtcactgttccggaaggcttcgcataccggatt
ccggcccggtttgattcactgacggctgccccactgctttgcgccggaatcatcggctat
cgggcatatgaacgggctaacgtccctgcaggcggcaccttgggcctgtatggtttcggt
ggctcggctcatctaaccgcccaaattgcaatgaaacaaggcatcgaggttcacgtttta
acccgtggtgaagatgccaggaaatttgccctgcagctgggagcggcctcagccagagga
acctatgatatgccacccgttaagctggattcggcaatcaactacacaccggtgggtgac
gtggttccaaaagccatggaagcgctgaaaccaggtggcacgttggcaatggccggtatc
cactcaacagatattccgcaaatgagttatccaagtcacattttccatgaaaaaaatctc
accagtgtcgaaagcaacacccgccgggatggtgaagagttcctgacattggctgatcga
ctcaatatccatccggaggtcactgaatatccgttggccaaagctgacgaggcactgaaa
tatattgccaaaggtgatattcgtggggcctgtgttttaagagtcagtgagggctaa

DBGET integrated database retrieval system