KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1374Help
Entry
Lbuc_1374         CDS       T01477                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lbuc_1374
DNA repair and recombination proteins [BR:lbh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lbuc_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444179..1444778)
Genome map
AA seq 199 aa AA seqDB search
MQYPEAIAKLIDSYMKLPGIGSKTATRLAFYTVDMNEDDVKAFSKALVATKNDLHYCSIC
GNLTDEDPCEICRDKTRDQSTILVVEEPKDVMVMEKVQEYHGLYHVLHGVLSPIEGKGPE
DLNISSLIKRLQQNKAVKEVIVATNATPEGEATAMYLSKLIKPAGIKVTRLAHGLSVGSD
IEYADEVTLFKAVQGRTEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaagcaattgcaaagttaattgatagttatatgaagttaccgggaatc
gggagtaagacagctaccagacttgctttttacaccgtcgatatgaatgaagatgatgtc
aaagcgttttcaaaggcgctggttgccaccaagaacgaccttcattactgttcgatttgt
ggtaatctaaccgatgaagatccctgtgaaatttgtcgtgataaaacccgtgatcaatca
accatcctagtggtggaagaacccaaagacgtgatggtaatggaaaaggtccaggagtac
cacggcctttatcatgttttgcatggggtactgtcaccaattgaaggcaaaggacctgaa
gaccttaatattagttcactgatcaaacgactccagcaaaataaagccgttaaagaagtg
attgtggccaccaatgccaccccggaaggcgaagccactgcaatgtacttgagcaagttg
attaaacccgctgggatcaaagtgactcgtttggctcacggattatccgttggatcagat
atcgaatatgctgatgaagtcacgttgtttaaggcagtccaaggacggactgaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system