KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1480Help
Entry
Lbuc_1480         CDS       T01477                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbuc_1480
   01230 Biosynthesis of amino acids
    Lbuc_1480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_1480
  Energy metabolism
   00680 Methane metabolism
    Lbuc_1480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbuc_1480
Enzymes [BR:lbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lbuc_1480
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lbuc_1480
  Exosomal proteins of melanoma cells
   Lbuc_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1525143..1525814)
Genome map
AA seq 223 aa AA seqDB search
MPTLVIMRHGESQANRDNIFTGWSDVPLTDKGVRQAHSAGKVIAKSQIQFDDVHTSFLKR
AIITTNIVLDEIGQNFIPEHKSWRLNERHYGGLRGKNKLKVKERVGAKQLKIWRRSFTVV
PPLLAKRDEDPRYDRYGVQIPLGESLEMAQQRLIPYWVDQIAPKLLDNKNQLIVAHGSTL
RALIKFLENISDEEIPNVEVPNGKPIRYDFDEQLNIISKSFME
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgccaacactagtcatcatgcgccacggagaaagccaagccaaccgggacaatattttt
accggctggagcgatgtacccttgaccgataaaggggttcgacaggcccacagtgctggg
aaagtgattgccaaatctcaaattcagtttgatgacgttcatacgtcatttctgaaacgg
gcgattatcaccaccaacattgtcttggatgaaattggtcaaaactttattccggagcat
aaatcctggcgccttaacgaacgtcactacggtggccttcgtgggaaaaataaacttaaa
gtcaaagaacgggttggcgcaaagcagctcaaaatttggcggcgaagttttaccgttgtg
ccgccgcttttggccaagcgggacgaagatccccgttatgatcgttatggtgtccaaatt
ccgttgggcgaaagtctggaaatggcacaacagagattgattccatactgggttgatcag
attgcgccgaagttgttagacaacaagaaccaattgattgtcgctcacggaagtacctta
cgcgccttgatcaaatttctggaaaatatttcagatgaagaaatccccaacgtggaggtt
cctaacggcaaaccgattcgatacgatttcgatgagcaattaaacattatcagtaaatcg
ttcatggagtag

DBGET integrated database retrieval system