KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1840Help
Entry
Lbuc_1840         CDS       T01477                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lbuc_1840
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lbuc_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1901963..1902532)
Genome map
AA seq 189 aa AA seqDB search
MKNRVFVITGAAGSGKTTVRDYLHDQYQMARVITHTTRPPRENERDGVDYYFEDDQSFFD
NHFLESVHYAGHYYGSSYEGLENAWEKSPFATIVLDTAGAITYKQKLGEKAVIIFLQVGD
TEELKRRMQGRGDNAEMVAKRVSSKEYHRDLEMPYELQGKAYQVVNQDWQQTRQQIDKIV
ENYRQETAG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcgagtatttgtgattaccggagccgctggcagcggcaagacaaccgttcgt
gattatttacatgaccaatatcaaatggcccgggtgatcacccacaccacccggccgccg
cgggaaaatgaacgtgacggggtggactattattttgaggacgaccaatcgttctttgac
aatcactttttggagtccgtccactatgccggccactattatggttcatcctacgaaggc
ttagagaatgcctgggagaaatcaccatttgcgacgattgtcctggacactgccggagcc
attacatataagcagaaactgggcgaaaaggcagtcatcatttttctgcaggtcggcgat
actgaagaactcaaacgccgaatgcaggggcgtggtgacaatgctgagatggttgccaaa
cgggtcagcagtaaggagtatcatcgtgatctcgaaatgccttatgaactgcagggcaag
gcttatcaagtggttaaccaggattggcagcagacgcgtcaacaaattgataaaatcgtt
gagaattatcgtcaagaaacggcgggatag

DBGET integrated database retrieval system