KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1855Help
Entry
Lbuc_1855         CDS       T01477                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lbh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920854..1922332
Genome map
AA seq 492 aa AA seqDB search
MKLNNQAMLITYPDSLGNNIKDLQKVLSTYLDGVVGGVHLLPFFPSSGDRGFAPMDYTKV
DEKFGNWDDVKKLSESYYLMFDFMVNHISKQSKYFKDFQANHNQSAYRDLFIHWNEFWPK
GRPTQEDVDLIYKRKPKAPVQTVKFADGQTEDVWNTFGEDQIDLNVTSKVTKQFIKDTLN
FLMDHGASIIRLDAFAYAIKKLGTNDFFVEPEIWDLLKEISDITSPRETTLLPEIHENYH
IVRKITDHDYFSYDFALPIVTLYSLYSGKASRLAGWLKNSPMKQFTTLDTHDGIGVVDAK
DILSDEELDYTKAEMYKVGANVKKVYSSTAYHNLDVYQINTTYYSALGDNDHAYLLARAI
QVFAPGIPQVYYVGLLAGKNDLGLLEKTKEGRNINRHYYSLDEVAEETKRPVVKALFDLL
RFRNQSSAFDLEGGIDVQQNGDNEIVVTRRSEDGQTSATLSANLQTQAFTITETNSEGET
KEILTSNLSAVK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaacaatcaagcaatgctcattacctatcccgatagtttgggaaataatatc
aaagatttgcaaaaagtcttgtcaacatacctggacggtgtcgttggtggtgttcacctg
ctgccattcttcccgtcatctggtgatcgcggtttcgcaccgatggattataccaaagtg
gacgaaaaatttggcaattgggacgacgtgaaaaagctgtccgagtcatactatttaatg
tttgacttcatggtcaaccatatttcgaaacaatccaaatactttaaagatttccaagct
aaccacaatcagtctgcttatcgggatctgttcatccactggaatgaattttggcccaag
ggtcgtccaactcaagaagatgttgatttaatttataagcgcaagccaaaggcccctgtt
caaacggtcaaatttgccgatggtcagaccgaagatgtctggaacacctttggtgaggat
cagatcgatctgaatgtgacttccaaggtaaccaaacagttcatcaaagataccttgaac
ttcttgatggaccatggtgcttctatcattcgcctggatgccttcgcttacgccattaag
aaactcggcaccaacgatttcttcgtagaaccggaaatttgggatctactgaaagaaatc
agtgacatcactagtccacgtgagaccaccttattgcccgagatccatgaaaactaccat
attgtccgaaagattaccgaccatgattacttcagctatgactttgccttaccaattgtc
actttgtatagtctttactcaggcaaagcaagtcgcttggccggctggcttaagaacagt
ccgatgaaacagttcacgactttggatacccacgatggcattggtgttgtggatgccaaa
gatattctatcggacgaggaactggattacaccaaagctgaaatgtataaagtcggcgcc
aacgtcaaaaaggtttattccagtactgcttaccataaccttgacgtttaccagatcaat
accacatactactcagctctaggggataacgatcacgcttacctgcttgcccgcgccatt
caagtctttgcaccagggattcctcaggtttactatgtcggcctgcttgccggtaagaac
gatctgggcttgctggaaaagaccaaggaaggccgcaatatcaaccgtcactattactca
ttggatgaagtggctgaagaaaccaaacggccagtcgtcaaagcattgtttgatctcctc
cgtttccgtaatcagagctcggcgtttgatttggaaggtggaattgacgtccaacagaat
ggtgacaatgaaattgtggttacccgccgatccgaagatggtcagacttccgcaactttg
tccgctaacttgcagacccaagcctttaccattacggaaaccaattctgaaggcgagact
aaagaaatattaaccagtaatttgtcagcagttaaataa

DBGET integrated database retrieval system