KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1929Help
Entry
Lbuc_1929         CDS       T01477                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lbuc_1929
  Amino acid metabolism
   00300 Lysine biosynthesis
    Lbuc_1929
Enzymes [BR:lbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Lbuc_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2008069..2009214
Genome map
AA seq 381 aa AA seqDB search
MAVFSEEQRLQIFKELVAIQSVNTDEEKVSAYLKNLFEKHGISATIIPVDENRTDLKAEI
GTGSPVLGVSGHMDVVSPGDTSKWTSDPFTLTERDGKLYGRGAADMKSGLAAMVIAMIEI
HDQGLLKKGRIRLMATMGEEVGELGSRTFADDGSMDDVDALIIGEPSGYRIAYAHKGSMD
IRLTSTGKAAHSSMPEQGYNALDPLIDLLHDANHQFRTTNKKSAMLGNLAFNTTIFKGGD
QVNSIPAKAVADINVRTIPEFDNDVVDKLLDQLVEQQNTNGAKIVKETYMSQPSVETTGD
KKLIGLAQEIGKQYAEKDIPSGAIPAVTDASNMLRDKPKEFPFIIFGPGSNSVHQVDEFV
DKQMYLNFVEIYQKLFTQYLN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcggtattttcagaagaacaacggctgcaaattttcaaagagctcgtcgcgattcaa
tcggtgaacactgatgaagaaaaggtcagcgcttatttaaaaaatctttttgagaaacat
ggcatttcggccacaattatcccggtcgatgaaaatcggacggatctaaaagcagaaatc
ggcactggcagcccagtcctgggagtctccgggcacatggatgtcgtttcaccgggggat
acctctaagtggaccagcgacccgtttacattgaccgagcgcgacggcaagttatacggt
cgtggtgctgctgatatgaaatccgggttggctgcaatggtgattgccatgattgagatt
catgatcaaggattgctgaaaaagggtcggattcgtctcatggcaaccatgggcgaagaa
gttggcgaattaggttcacgaaccttcgctgacgatggctcaatggacgacgttgatgca
ctgatcatcggtgaaccatccggctaccgaattgcctatgcccacaaagggtcaatggat
attcgcctaacctcaactgggaaagctgcccatagttcaatgccggagcagggctacaat
gcgctggatccactgattgatctcctgcacgacgccaatcatcaatttagaacaacaaat
aaaaagagcgcaatgttgggaaatctggcatttaacacgacgatcttcaagggcggggat
caagtcaactcaattccagccaaagctgttgccgatatcaacgttcgcaccatcccagag
ttcgataatgatgtggtcgataagctactggatcaactcgttgaacagcaaaataccaac
ggggccaaaatcgtcaaggaaacttacatgtctcaaccatcagtcgaaacgaccggcgac
aaaaagctgatcggcttggcacaggaaatcggcaaacaatatgccgaaaaagacattccg
agcggtgccatcccagctgtcaccgacgcatcgaacatgctgcgggataagccgaaggaa
tttccatttatcatctttggtccaggaagtaacagtgtccaccaagttgatgagtttgtc
gacaaacagatgtaccttaactttgtggagatttatcagaagttgtttacgcagtatttg
aactaa

DBGET integrated database retrieval system