KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1999Help
Entry
Lbuc_1999         CDS       T01477                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00330  Arginine and proline metabolism
lbh00332  Carbapenem biosynthesis
lbh01100  Metabolic pathways
lbh01130  Biosynthesis of antibiotics
lbh01230  Biosynthesis of amino acids
Module
lbh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lbuc_1999
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lbuc_1999
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lbuc_1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DUF5099
Motif
Other DBs
NCBI-ProteinID: AEB74245
UniProt: F4FU86
Position
2090181..2090996
Genome map
AA seq 271 aa AA seqDB search
MDKRIINANRIVVKVGTSSLIHPNGAVNLKTFDELAYTLSALNNQGKQLVLVSSGAIGVG
LNKMHLKKRPTEIGAQQALAAIGQSELMTLFTQRFDHYLTDIAQVLLTHDIFDYPKSNQF
VMNTFNCLLRDNVIPIVNENDTVATDELDHKTTFGDNDQLSAIVASHVDADLLIVLSDVD
GFYDQNPNKVADANLIRTVSHVDENEFGVAGGTGSRFGTGGMQTKLLAAKRMLDEDRIMV
LANGADPRIIFKILAGKDVGTIFQKESVAHE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacggattattaacgcaaatcgaatcgtggtcaaggttggtaccagcagcctg
atccacccaaacggtgcggtcaacttgaagacttttgatgagctggcgtacactttgagc
gcgctgaataaccaaggcaagcaacttgtcctggtttcctccggggcaattggggttggc
ttgaacaaaatgcacctcaagaaacggccaaccgaaattggtgcccagcaggctttggct
gctattggtcagtcagagttgatgacgctgtttacgcaacgattcgaccactatctgaca
gacattgctcaggtgcttttgacccatgatatctttgattatcccaagagcaaccagttc
gttatgaacaccttcaattgtctactgcgggacaatgtgatcccgattgtcaacgagaat
gacacggtggccactgatgagttggaccacaaaaccacttttggcgataacgaccaactt
tcagcaatcgtggccagccacgtggatgcagatttgctgatcgtcttgtcagatgtcgac
gggttctatgatcaaaatcctaataaagtcgctgatgccaatctcatcagaaccgtgagc
cacgttgatgaaaatgaatttggtgttgccggcgggaccggcagccgctttggaaccggc
ggcatgcagactaagctgctggccgccaaacgaatgctcgacgaagaccggatcatggtt
ttggccaacggtgccgatccacgcattatttttaaaattttagccggcaaagatgtggga
acgatctttcaaaaggagagtgtagctcatgaatga

DBGET integrated database retrieval system