KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2021Help
Entry
Lbuc_2021         CDS       T01477                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbuc_2021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_2021
   00052 Galactose metabolism
    Lbuc_2021
   00500 Starch and sucrose metabolism
    Lbuc_2021
   00520 Amino sugar and nucleotide sugar metabolism
    Lbuc_2021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lbuc_2021
   00524 Butirosin and neomycin biosynthesis
    Lbuc_2021
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lbuc_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2111507..2112472)
Genome map
AA seq 321 aa AA seqDB search
MTKYYLGVDLGGTNIKAGLFDEDFQTVQKLHKPTHEEAGPTEVLKRIWACCQQLMAQEKI
TSDDILAAGFGIPGQMDVEKGISIFSPNFTDWKDVPVAEWLHEKLGQPVFIDNDVRVNLY
GEMAFGAGRGHRNVVLVTIGTGLGAAVLINGQVLYGASNSVGEIGHKNMYRHGRPCACGS
TGCLGRYVSARGIVKTMQEKLADGETSLVGEWMSQGQELTTKLISEAVAKGDPTAIEVFK
ETGELLGFGLGNVINLFNPETLILGGGVSAAGEPLFKYTRETLAHHSLPVAREACKLEMA
QLGDEAGMVGAAVYAGQKIRV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatattatttgggtgttgatcttggcgggaccaacattaaggccggactgttc
gatgaggattttcaaacggtccaaaaattacataagccgactcatgaagaggccggtccc
actgaagtactgaagcggatctgggcgtgctgccagcaattaatggctcaggaaaagatt
acctcagatgatattttggctgccggctttggcattcccgggcaaatggatgtggaaaag
gggatttcgattttttcaccgaattttaccgactggaaggatgtcccggtcgccgagtgg
ctgcatgagaagctgggccaaccggtcttcattgacaacgatgtccgagttaatctgtac
ggcgaaatggcgttcggggccggaagaggtcatcgaaacgttgtcctggtcacgattggt
actgggctgggcgcagctgttctgattaacggccaagtgttatatggcgcttccaatagt
gtcggtgagatcggccacaagaacatgtaccgccacggccggccatgtgcttgcggcagt
accggctgtctgggacggtatgtttccgctcgcgggatcgtcaaaaccatgcaggaaaaa
ctggctgacggcgaaaccagcttggttggcgaatggatgtcacaagggcaggaactgacc
accaaattgatctcggaagcggtggcaaaaggagatccaacagctattgaagtctttaaa
gaaactggcgagttgctgggatttggtttgggcaacgtgattaatttgtttaatccggaa
acgttaatcctgggtggcggtgtctcggctgccggagagccattgttcaaatatacccgc
gaaaccttggcgcatcattcactgccggtggcccgtgaagcctgcaagctggagatggcg
cagctgggcgatgaagcaggaatggtcggtgcggcggtgtatgcggggcaaaaaataaga
gtgtga

DBGET integrated database retrieval system