KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2103Help
Entry
Lbuc_2103         CDS       T01477                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_2103
   00052 Galactose metabolism
    Lbuc_2103
Enzymes [BR:lbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Lbuc_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2200420..2201436
Genome map
AA seq 338 aa AA seqDB search
MNTKKELFDKLDGQDIEKFTITNDHNVSVSAITFGATLEEFNVPGPDGKPTNILVSVPSS
EELMKNQYFCQAIGRTAGRITNGTFKIKGQEYHVDSNEGTTTLHGGPHGFNTQIWDGSFD
GDTIVFTKHIDSSEDSFPGNIDVKITFSLNNDNELTATYSAKSDADTLFNPTQHMYFNLS
EGDSINGQSLQINADKYLELNKDKTPTGKKVAVDDTPYDFRDNQNLKVGIADMKAEVGHS
YDEVFEINDHQDDEPVATLSDPESGRSISISSKRNALVVFTPDDLTGTNYLRGKGGPYMA
IALEAQNLPDTPNHEDFGDVTLPAGEEKTYSIKYKVEF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaagaaagaattgttcgataagttagatggtcaagacattgaaaagttcacc
attaccaacgatcacaacgtttctgtttcagcaattacctttggggcaaccctggaagaa
ttcaacgttcccggacctgacggcaaaccaaccaatattttggtcagtgtgcccagcagt
gaagaattgatgaagaatcaatacttctgccaagcaatcggtcgaaccgccggccgaatc
accaacggtactttcaagatcaagggtcaggaataccacgttgattcaaacgaaggcacc
acgactttgcatggtggcccccacgggttcaacacccaaatctgggacggatcatttgat
ggtgacaccatcgtcttcaccaagcacatcgactcttctgaggattcattccccggcaac
atcgacgtcaagattactttctcactcaataacgataatgaattaaccgctacttacagt
gccaagagtgacgccgacactttgttcaacccaacccagcatatgtacttcaacttgagt
gagggtgacagcatcaacggccaatcacttcaaatcaacgccgacaagtaccttgaattg
aacaaggacaagacaccaaccggtaagaaagtcgccgtggatgacaccccatacgacttc
cgcgataaccaaaacctcaaagtcggtatcgccgacatgaaggccgaagttggtcacagt
tatgatgaagtctttgaaatcaatgaccatcaagacgacgaaccagtcgcaaccttatcc
gatcccgaaagtggccgcagcatttcgatcagttccaagcgcaatgcattggttgtcttc
acaccggatgatttaaccggcaccaactatctccgcggaaaaggcggcccatacatggca
attgctttggaagcccaaaacttgccagacacccctaaccacgaagactttggtgatgtc
accttgccagctggtgaagaaaagacctacagcattaagtacaaggttgaattctag

DBGET integrated database retrieval system