KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2143Help
Entry
Lbuc_2143         CDS       T01477                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lbuc_2143
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_2143
   00620 Pyruvate metabolism
    Lbuc_2143
   00650 Butanoate metabolism
    Lbuc_2143
  Lipid metabolism
   00071 Fatty acid degradation
    Lbuc_2143
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lbuc_2143
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lbuc_2143
   00626 Naphthalene degradation
    Lbuc_2143
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lbuc_2143
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Lbuc_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2254273..2256891)
Genome map
AA seq 872 aa AA seqDB search
MIDNKVKETKAAKTNTTDVDTVINGLVSKAQKALEIMDSFDQEKVDHITHQMVMAGQDKH
MDLALMAYEETGRGVAEDKAIKNMYATEEVWHSIRDHKTVGVIKDDKERQLITVAEPLGV
LAGITPVTNPTSTTLFKSIISMKTRNPIIFSFHPQALKSSIAAAKIVRDAAIAAGAPEGC
IQWIEEPSIEATTKLINHPGVASTLATGGPGMVKAAYSTGKPALGVGPGNGPVYIEKTAN
ILRAVNDLVLSKTFDNGMICATENSAVIDSDIYAEVKKELVKNGVFFVDKKDHDKLAEAM
FNPKTGSVKGPIAGKSAKGIAKLAGIKVPDNTKVLAAEITGVGPKYPLSAEKLSPVISIY
KAKNHEEGFKLCDELLHFGGMGHTAGIQTLDDDLALEFGKQMKAARVLVNTPGGFGGIGN
LYNEMTPSLTLGTGSWGANSISHNVTDYDLLNIKTIAKRRNNMQWIKLPRVYFEKTSVRY
LMDMPGINKVFIVTSPEMVEFGYVDKVLDELKRRPNPIEYSLFSGVEPDPTTDTVEKGVR
QMNAFKPDTIIALGGGSPLDAAKNMWLFYEDPKTSFFGAKQKFIDIRKRAYRFNKPKKAQ
MIAIPTTSGTGSEVTPFAVITDSKTHVKYPLADYALTPDVAIVDPQFVETVPKGNIAASG
LDTLCHGIESFVSTMASDYTRPLSLQAIKLVFDNLADSYNGNMHAKEEMHNAATLAGMAF
GNAFLGINHSIAHKLGGEFGLTHGIAIAITMPHVIRYNAKLPEKIAVWPKYEYFRANKDY
AEIARYVGIQGKNDDELIEGLVQRIIKLAHEVGVTLSLKAWGVDKAKFDAAVDRLAVLAY
EDQCTTANPKEPLIADLKQLMIDDYEGTNVEK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgattgataataaagtaaaagaaaccaaagcagctaagacgaacacaactgatgttgac
actgtcatcaacggcttggtatcaaaagcgcaaaaagcacttgaaattatggattcattt
gaccaagaaaaagttgaccacatcactcaccaaatggtaatggccggccaagacaaacac
atggacctggcactcatggcttatgaagaaaccggccgtggagttgctgaagacaaggcc
atcaagaatatgtacgccactgaagaagtttggcacagcattcgtgatcacaaaacagtt
ggtgtcattaaagacgataaagaacgtcaattaatcaccgttgctgaacctttgggtgtc
ctggccggaattacaccagttaccaacccaacttcaaccaccttattcaaatcaattatt
tcaatgaagactcgaaacccaatcatcttcagtttccacccacaagcattgaagtcatca
attgcagccgctaagattgttcgcgacgctgcgattgctgccggcgctcccgaaggctgc
attcaatggattgaagaaccaagtatcgaagccacaacgaaattaatcaaccacccaggt
gtcgcaagtaccctggcaactggtggtccaggcatggttaaagctgcttactcaactggt
aagccggcattgggtgttggtcctggtaacggtccggtttacatcgaaaagactgccaac
atcttgcgtgctgttaacgacctggtgctctcaaagacctttgataatggtatgatctgt
gccactgaaaacagcgcggttatcgattctgatatctacgctgaagttaagaaggaatta
gttaagaacggtgtcttctttgttgataagaaggaccatgacaaattggcagaagcaatg
ttcaaccctaagactggcagtgttaagggtccaatcgccggcaaatcagctaaagggatt
gccaaactggctggtattaaagtacctgacaacaccaaagttctggctgctgaaattact
ggcgttggtcctaagtacccactgtcagctgaaaaactcagcccagtgatcagtatttac
aaagctaagaaccatgaagaaggtttcaaactctgtgacgaattacttcactttggtgga
atgggccacactgccggcatccaaactctggacgacgacttggccttggaatttggtaag
cagatgaaggctgcccgggttctggttaacacaccaggcggcttcggtggaattggtaac
ctttataacgaaatgaccccatcattgacattgggaactggctcatggggtgccaactca
atttctcataacgttaccgactatgaccttttgaacatcaaaactatcgcaaagagacga
aataatatgcaatggattaagttacctcgggtttactttgaaaagacttcagttcgttac
ctcatggacatgcctggcattaacaaggtattcatcgttaccagtccagaaatggttgaa
tttggctacgttgacaaggtgcttgatgaattgaaacgccgtccaaacccaatcgaatac
tcactgttctcaggtgttgagccagatccaaccactgacacagttgaaaagggtgttcgt
caaatgaacgcattcaagcctgacacaatcatcgccttgggtggtggttcaccattggat
gctgccaagaacatgtggttattctacgaggatcctaagacgagtttcttcggcgccaag
cagaagttcatcgatatcagaaagcgggcataccgtttcaacaagcctaagaaggcgcaa
atgatcgctatcccaacgacttccggtactggttcagaagtaaccccattcgctgttatc
actgactcaaagacccacgttaagtacccattagctgactatgctttgacacctgatgta
gcgattgttgacccacaatttgtggaaactgttccaaagggtaacattgccgcttccgga
ttggatactttatgccacggaatcgaatcattcgtttcaaccatggcatctgattacact
cgtccattgtcactgcaagccatcaagctggtatttgacaacttggcagactcatacaat
ggcaacatgcacgctaaagaagaaatgcataacgccgcaaccttagccggaatggcattt
ggtaacgcgttcctgggaattaaccattcaatcgcccacaaactgggtggggaattcggc
ttaacccacggaattgccattgcaatcacgatgccacacgttatcagatacaatgccaaa
ttaccggaaaagatcgccgtatggcctaagtatgagtacttccgtgccaacaaggactac
gcagaaattgccagatacgttgggatccaaggtaagaacgacgatgagttaatcgaagga
ttagttcaaagaattatcaagttggctcacgaagttggcgttaccttaagcttgaaggct
tggggcgttgataaagccaaattcgatgcagcagttgaccgtcttgcagtattagcatac
gaagaccaatgcacgactgctaacccaaaggaacctttgattgccgatttgaaacagttg
atgattgacgattatgaggggactaatgtggaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system