KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2306Help
Entry
Lbuc_2306         CDS       T01477                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lbh00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lbh00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2438581..2440086
Genome map
AA seq 501 aa AA seqDB search
MNKYYTSTRNGSVQISAKQAIKKGFADDKGLFVYPDLEKLQVNFEKLLKLNYQDIARAVL
TILLPDFSADEIDESVRAAYQSSFDTQKITPVIPVDDFHILELFHGPTSAFKDVGLQLLP
QLMKHVLVGNNKVMILTATSGDTGKAALEGFKGLDNMGIIVFYPDGGVSKIQKLQMITTG
GNNTKVAAIEGNFDDAQTNVKRIFNDQALKESLGDDVSLSSANSINIGRLIPQVVYYFDS
YKQLVNDSSIEVGQKVNFTVPTGNFGDVLAGYYAKMLGLPVNKFVVACNENNVLANFFNH
GVYDRNRPFFQTVAPSMDIQISSNFERLLYYKSGQDTEYVKQLMDDLEDSGKYEVSKEVL
ANIQQDFYCGYSTDEDIERSIAEVYEQNGYLMDPHTAAGYKVMRNYQKLDPETPMILLST
ASPYKFVNAVANAVLPETSADVQQVMRDLHDATNAPIPDNLRKVWDLPVRHESVIQKDQM
TDYVKQKVEEVFYDQDQSARN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatattatacgagtaccagaaacggttcagttcaaatttcagccaagcaggcc
atcaagaagggcttcgctgatgacaagggtctcttcgtttatcctgacttggaaaagctc
caagtaaacttcgaaaaattgttaaaattaaattatcaagatattgccagagcagtgctg
acgattttattgccggacttttctgccgatgaaattgacgaaagtgtccgagcagcttat
cagtcaagttttgacacccaaaagattaccccggttattcccgttgatgatttccatatc
ttggaacttttccatggaccaaccagtgcctttaaagatgttggcttgcagctattgcct
caattgatgaagcacgtgttagtcggcaataataaggtaatgatcctgacggctaccagt
ggcgacactggcaaagccgccttggaaggctttaagggcttggataacatgggcattatt
gtcttctatccagacggtggtgtcagcaagatccaaaagctgcagatgatcacaaccggt
gggaacaacaccaaggtcgcagcaattgaaggaaattttgatgacgctcagacaaacgtt
aaacggattttcaatgatcaggcactgaaggaatcccttggtgacgatgtcagcttatca
agtgccaactcgatcaatatcggccgactgattccccaagtcgtttattattttgattcc
tataaacagttggtcaacgatagctcgattgaagtcggccaaaaggtcaacttcaccgtt
ccaaccggtaactttggtgacgtcctggccggctactacgccaaaatgctgggccttccc
gtgaacaaatttgtcgtcgcatgtaatgaaaataacgtgttggccaacttctttaatcac
ggggtctacgatcgcaaccggccatttttccagaccgttgctccaagtatggacatccaa
atttccagcaactttgaacgactcctctactataagagtggtcaggacaccgaatacgtt
aaacaattgatggatgacttggaagacagcggcaagtatgaagtttccaaggaagttctg
gcaaatatccagcaggatttctactgcggctacagtaccgatgaagatattgaacgctca
atcgccgaagtctacgaacaaaacggctacttgatggatccccataccgcggccggctac
aaagtcatgcgcaattatcaaaagctcgaccccgaaacaccaatgatcctgttaagtact
gccagtccctataaattcgtgaatgcggttgccaatgccgtccttccagaaacttcagcg
gacgtccagcaggtgatgcgggacttacatgacgcaaccaacgcaccaattccagacaac
ctgagaaaagtctgggatctgcccgtccgtcacgaaagcgtcatccaaaaagatcaaatg
accgattacgtcaaacaaaaagtcgaggaggtattttatgatcaagatcaaagtgcccgc
aactag

DBGET integrated database retrieval system