KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2398Help
Entry
Lbuc_2398         CDS       T01477                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lbuc_2398
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Lbuc_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pLBUC01:complement(26782..27702)
Genome map
AA seq 306 aa AA seqDB search
MMTKSDVLVIGSNMIDLISYIDRMPVEGETVEAPDFQMGFGGKGANQAVAAARLGSKVSF
ISMVGNDAFGQQQLDNFKNNHINITGVGVGTKSSGAAPIFVDKSSDNRILIIKGANNELT
PEVLDKYADLIKNTKIIVLQQEIPLETNYHAIDLANQYHIPILLNPAPANKDLDINHVTK
VDFFSPNETELATLTGMPTNDMDEIKKAAHHMIKLGVKNMLITLGSKGVLWVNESTSQLI
KAIKVNAVDTTGAGDSFIGSFAHYYASGDDIPTAIKHANQYAAVTVTRRGTQKSYPTADE
LSLLVK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaaaagcgatgtcttggttattggctcaaatatgattgacctaatttcatat
attgatcgaatgcccgttgaaggagaaactgtagaggcacctgactttcaaatgggcttt
ggcggtaaaggtgcaaaccaagcagtcgctgctgctcgcctcggttcaaaagtaagtttt
atttcaatggttggtaatgatgctttcggacaacaacaattggacaactttaaaaataac
catatcaacataactggtgttggtgtaggaacaaaaagcagcggggcagcacctattttt
gtcgataagagttcagataatcgaattctgattataaaaggtgcaaataatgaactcaca
ccggaagttctagataaatatgcagatttaatcaaaaatacaaaaatcattgtcttacaa
caagaaattccactcgaaacaaactaccatgcaatagaccttgcaaatcaatatcacatc
ccaattcttctaaacccagctccggcaaataaagatcttgatattaaccatgtcacaaaa
gtagatttcttctcaccaaatgaaacagagttagcaacacttacgggaatgccaactaat
gatatggacgaaatcaaaaaggctgctcatcacatgattaagctaggtgtaaagaacatg
ctaataacactggggtcaaagggtgttctctgggtgaacgagagcaccagtcagcttatt
aaagctataaaagtaaatgccgtagatactactggagccggtgattcgtttatcggatcg
tttgctcactattacgccagcggtgatgacattccaactgcaataaaacatgcaaaccaa
tatgcagctgtcacggttacccgccgaggaacacagaaatcctatccaacagctgatgaa
ttatccttacttgtaaaataa

DBGET integrated database retrieval system