KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0188Help
Entry
LEPBI_I0188       CDS       T00693                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LEPBI_I0188
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LEPBI_I0188
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LEPBI_I0188
Lipid biosynthesis proteins [BR:lbi01004]
 Desaturase
  First
   LEPBI_I0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:184242..185177
Genome map
AA seq 311 aa AA seqDB search
MNSASSSVEPVVKEQAPFLFLVLFFLVQATVLLVFTVPFSWNLVWVAVGSYFLRMFGITG
AYHRYFSHASFKTSRVFQFVLAWIGAMSMQKGALWWAAHHRNHHKYSDTEKDIHSPSRKG
FWYSHMFWFLRDDYNDYEAKLIPDFYKFPELRWLDRNHWIPPLTYAILLYVVGGWGWLVY
GYAVSTFILGHATWTINSLSHVYGSVRYESRDTSKNNVWLALLTMGEGWHNNHHYYCSSV
NQGFYWYEIDVTYYILKVLSWFGIVWDLKKPPKKVLDEGMSRDLTKKQEKMEASKNRAEA
KNKKKVEVLSA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgcatcttcttcggtggaacctgttgtcaaagaacaggcaccttttcttttt
ctagttttatttttcctcgtccaagcgactgtcttattggtatttaccgtcccgttttcc
tggaatttggtttgggttgctgtcggttcttatttccttcgtatgttcgggattactggt
gcttaccaccgttatttttcccatgcctctttcaaaacatctcgggtctttcaatttgtt
ttggcctggattggagcaatgtccatgcaaaaaggtgccctgtggtgggcggcacaccat
aggaaccatcacaaatactcggataccgaaaaggacatccattctccgagcagaaaaggt
ttttggtattcccatatgttttggtttttaagagatgattacaacgactacgaagcaaag
ctcatccctgacttttacaaattccccgaactcagatggcttgatcgtaaccattggatc
ccaccgttaacgtacgcgatcctcttgtatgttgttggtggatggggttggcttgtgtat
ggctatgcggtttcgacattcattttaggccacgctacatggaccatcaattcactttct
catgtgtatggttcggttcgttatgaatcgagagatacaagtaaaaacaatgtttggctt
gccttactcacgatgggtgaaggatggcataacaaccaccattactattgttcgtcggtg
aaccaaggtttttattggtatgagattgatgtgacctattacatcctgaaagtactcagt
tggtttgggattgtttgggatttaaaaaaacctcctaaaaaagtgttggatgaagggatg
agtcgtgacctaacaaaaaaacaagagaagatggaagcttcaaaaaacagagctgaggca
aaaaacaaaaagaaagtggaagtcctatctgcttaa

DBGET integrated database retrieval system