KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0238Help
Entry
LEPBI_I0238       CDS       T00693                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LEPBI_I0238 (ispE)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LEPBI_I0238 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(228923..229843)
Genome map
AA seq 306 aa AA seqDB search
MVLLQTIAHAKINIGLMIPYKREDGLHEIRSVFVPIDFGDPMEIQIKSLPKGIVSRFVFH
STNHLQGYRHSLFEAVSERGDLSQNILTKTFHKLKPYFQEALEIKVQIQKHLPPEGGIGG
GSSNAGVLLQHLFPYTNLSRGEQIQFAKSIGADVPFFLQSSACFVTGIGEVMEPIRLAKG
FGILAIPPFGLSTGSMYASLQKSLQKPYGSEVWKSLTEDLIRSLHVGDWVYLQNRLENEF
EKIAFQTQPLLKELKLGFFESGAIFASLSGSGSCLYGIYPTEEKRNEALPNVSLRFPKME
FRTFSF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggttcttttgcaaacgattgcacatgcaaagattaacattggtttgatgattccttat
aaaagggaagatggactccatgaaatccgaagtgtctttgttcccattgactttggtgat
cccatggaaatccaaatcaagtccttaccaaaaggaattgtttccagatttgtattccac
tccacaaaccatttacaagggtatcgccattccctttttgaagctgtctcggaacgtggg
gacctttcccaaaatatcctcaccaaaacctttcataaactgaaaccctacttccaagaa
gctttggaaatcaaggtccaaatacaaaaacacctgcctcccgaagggggaattggcggt
gggagtagcaatgcgggtgttttattacaacacctgtttccctatacgaatctttcgcgg
ggagaacaaattcaatttgccaaatccatcggcgcggatgttccttttttcctccaatcg
agtgcctgttttgtgactgggattggggaagtgatggaacccatccgtttggccaagggt
tttgggattttggccatccctccctttggattatctaccggttctatgtacgcaagtctc
caaaaaagtttacaaaaaccctatggttccgaagtatggaaatctctgacagaggattta
attcgaagtcttcacgtcggggattgggtttacctgcaaaacaggctagagaacgagttt
gaaaaaatcgctttccagacccaacccttactaaaggaattgaaattagggttctttgag
tcgggagcaatttttgcgtctctttctggttctggatcatgtctttatggcatttatccg
accgaagagaaacgaaacgaagcccttcccaatgtctctcttaggttcccgaaaatggaa
tttcgaacgttctctttttag

DBGET integrated database retrieval system