KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0259Help
Entry
LEPBI_I0259       CDS       T00693                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lbi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lbi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:252066..253415
Genome map
AA seq 449 aa AA seqDB search
MSLTKYQFRAQFRCTNDSCRKTYPLHQVIYSCSSCGELLNVEHDLDSLKKIPAEEWKSTF
DSRFRSSQFPNASGVWGKKEWVLPEIQDQNIITSGEGTTHLYDASRFAKDLGLGSLHIKQ
CGVSHTGSFKDLGMTVLVSQVNQMIADGVPIKAVACASTGDTSAALASYAAKAGIPAIIL
LPANKVSTAQLIQPVSNGAIVLALETDFDGCMAVVKELTQEKSLYLANSMNSLRIEGQKS
ISVEITQQLGWKVPDWVVIPGGNLGNVSALGMGFEMMYELGLIGKLPRILLAQAKNASPL
YESYKKGFAEFSPVTAEKTLASAIQIGDPVSVKKAIRVLKKFDGIVEVATEEELANAAAK
GDLYGLYNDPHTGVALAALFKSIQKGTVGAGESVVVISTANGLKFTEFKLAFHEGKIPQV
DEALRNVILPCKPTLSGVMEILGKHLKKT
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttacaaaatatcaattccgagcacagtttcgctgtaccaatgactcttgtcgc
aaaacgtacccactccaccaagtgatttattcctgttccagttgtggagaacttctgaat
gtggaacatgatttagacagcctcaaaaaaatcccagcggaagagtggaagtctacgttc
gactctcgttttcgttcgagccaatttcccaatgcttctggcgtttggggtaaaaaagaa
tgggtgcttcccgaaatccaagatcaaaacatcatcacatccggggaaggaacgacacat
ttgtatgatgcctctcgttttgccaaagacttgggactggggagcctccatatcaaacag
tgcggagtttcccacacaggttccttcaaagatttaggcatgacagttcttgtcagccag
gtaaaccaaatgatcgccgacggtgttccgatcaaagcagtggcatgtgcatccactggt
gatacctcagctgctttagcttcttatgcggcaaaagcggggatccctgccatcatctta
cttccagctaacaaagtttcaacggcacaactcatccaacctgtatccaacggagccatt
gttcttgcattagaaactgactttgatggttgtatggccgttgtgaaagaactcacacaa
gaaaagtccctttacttagcaaattcaatgaattcccttcgcattgaagggcaaaaatcc
atttcagttgaaattacccaacaacttggttggaaggttcccgattgggttgtgatccct
ggtgggaatttagggaatgtgtctgctctcggaatgggatttgaaatgatgtatgagtta
ggactcattggtaaactcccaaggattttgttggcacaagcaaaaaatgcaagtcctctc
tacgagtcgtataagaaaggttttgcggagttctctcctgtgacggctgaaaaaacgtta
gcctctgccatccaaattggagacccagtctctgtcaaaaaagcgatccgtgttctcaaa
aaattcgacgggattgtggaagtggcgacagaagaagagttagccaatgcggcagcaaag
ggagatttgtacggactttataatgacccacacactggggtggcacttgcggctcttttc
aaatccatccaaaaaggaacagtgggagcgggtgagtcggtggtcgtgatttcgactgcc
aacggactcaaattcacagaattcaaacttgccttccacgaaggaaaaattcctcaagtg
gatgaggctctgaggaatgtaattttgccttgtaagccgacactttctggtgtgatggaa
atcctaggtaaacatttgaagaaaacataa

DBGET integrated database retrieval system